BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D06 (890 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 26 0.53 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 2.8 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 2.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.8 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 3.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 6.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 8.6 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 8.6 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 25.8 bits (54), Expect = 0.53 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 472 SHVLSCVIPLILWITVLPPLSELIPLAA 389 S +LS V+ L+L +LPP S ++PL A Sbjct: 270 SILLSLVVFLLLVSKILPPTSLVLPLIA 297 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 2.8 Identities = 13/47 (27%), Positives = 20/47 (42%) Frame = -2 Query: 145 HSSCGLSKLINVSYHVWIQLTLXKGRSAAAKYQHLNLKEFPIGSRRN 5 H GL + I + W+ + A Y +N E+P S+RN Sbjct: 142 HYRSGLKRAIRSIFGAWLIALIFA--MPFATYVDINYVEYPQNSKRN 186 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 23.4 bits (48), Expect = 2.8 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 493 GLLLAFCSHVL-SCVIPLILWITVLPPLSELIPL 395 G ++ CS +L S + +L ++PP S IPL Sbjct: 278 GEKVSLCSSILLSLTVFFLLLAEIIPPTSLAIPL 311 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.4 bits (48), Expect = 2.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 289 EKTSHTSTLNLKHKMNAIVVV 227 E T TLNLKH A++V+ Sbjct: 56 EDAEDTQTLNLKHLRAAVLVL 76 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.0 bits (47), Expect = 3.7 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 609 DTRRFPLEAPSCALLFRPCR 668 + R FP++ SC L+ C+ Sbjct: 165 ELRNFPMDRQSCPLILGSCK 184 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 715 KRHASRREKGGQVSGKRQGRNRRAH 641 KR +++ +G + + +NRRAH Sbjct: 39 KRPKTKKSQGSRTTHNELEKNRRAH 63 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 472 SHVLSCVIPLILWITVLPPLSELIPL 395 S +LS + +L ++PP S ++PL Sbjct: 277 SILLSLTVFFLLLAEIIPPTSLVVPL 302 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 8.6 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = -2 Query: 289 EKTSHTSTLNLKHKM 245 ++ H+STL++ HKM Sbjct: 238 DENRHSSTLDIDHKM 252 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 246,690 Number of Sequences: 438 Number of extensions: 5718 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28783482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -