BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D04 (890 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces po... 27 2.7 SPAC821.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 3.6 >SPAC17G6.03 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 1|||Manual Length = 635 Score = 27.5 bits (58), Expect = 2.7 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = -2 Query: 613 LSXLINVXYHVWIQLTLTKGRSAAXECGVVNSHSSNGVLGGDRYS 479 LS + N YH +I L +GR A + + H S+ V GDRY+ Sbjct: 130 LSTVANDTYHNFIPLW--EGRYLAANIDIYDEHVSSFVPFGDRYA 172 >SPAC821.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 485 Score = 27.1 bits (57), Expect = 3.6 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -1 Query: 404 DDADRELHYQSFKKHLAEINXLXEKNPYTTFGINKF-ADYTPEXQQSRL 261 DD+D E Y+ + L +KN Y+TF ++F TP QS L Sbjct: 367 DDSDSERSYRRVRDQYLSKPRLSDKNRYSTF--SEFPGQGTPSASQSNL 413 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,630,075 Number of Sequences: 5004 Number of extensions: 41494 Number of successful extensions: 79 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 448490560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -