BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D04 (890 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 32 0.54 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.54 SB_48351| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 773 CXNESANXRGXAVXYWALFXXP--LXDSLRSVVGCGXRYQ 886 C NESAN RG AV P L RS GCG RYQ Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARS-FGCGERYQ 138 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 32.3 bits (70), Expect = 0.54 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 773 CXNESANXRGXAVXYWALFXXP--LXDSLRSVVGCGXRYQ 886 C NESAN RG AV P L RS GCG RYQ Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARS-FGCGERYQ 502 >SB_48351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 969 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -2 Query: 838 RXTEKRPIRNRLSPGVGRFIXAEKTSHTSPLNLKHKMNAIVVVN 707 R +EK + + L G F+ E PL L H + +VVVN Sbjct: 10 RRSEKEEVNDHLGQLHGGFLRQEAGERLGPLVLNHSVTVLVVVN 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,456,068 Number of Sequences: 59808 Number of extensions: 304223 Number of successful extensions: 563 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 563 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -