BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D03 (940 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC821.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 29 1.2 SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharom... 27 5.0 >SPAC821.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 485 Score = 28.7 bits (61), Expect = 1.2 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 178 DDADRELHYQSFKKHLAEINQLNEKNPYTTFGINKF-ADYTPEEQQSRL 321 DD+D E Y+ + +L++KN Y+TF ++F TP QS L Sbjct: 367 DDSDSERSYRRVRDQYLSKPRLSDKNRYSTF--SEFPGQGTPSASQSNL 413 >SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 1462 Score = 26.6 bits (56), Expect = 5.0 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = -2 Query: 336 RQPQSQPALLFLRSIISKFVNAKRSIWILLVQL 238 R ++Q ALL L I SKF N + W LLVQL Sbjct: 866 RDFRAQLALLVLFWISSKFGNIIDASWPLLVQL 898 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,448,616 Number of Sequences: 5004 Number of extensions: 42101 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 477327454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -