BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_D02 (901 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 37 0.026 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 37 0.026 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 37 0.026 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 36 0.045 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.059 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.14 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.24 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.31 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 32 0.73 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 32 0.73 SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) 32 0.73 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_39066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.96 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 0.96 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 30 2.2 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 30 2.2 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 2.2 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 30 2.2 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 2.2 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 30 2.9 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 3.9 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 29 3.9 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 3.9 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 5.1 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_14664| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_4894| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 6.8 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 28 8.9 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 8.9 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 8.9 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 6/58 (10%) Frame = +3 Query: 570 PPPXPXGXGFX------GXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 PPP P G G PP PPP P GGA P P PP PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPP 644 P G PP P G PP PPP PP Sbjct: 966 PGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 29.1 bits (62), Expect = 5.1 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 11/63 (17%) Frame = +3 Query: 570 PPPXPXGXGF--------XGXGPPXPPP---KXXPPGXPXGGAXPXXXXGXKXFXPXPPR 716 PPP P G G P PPP PP P GG+ P G P P Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Query: 717 XPP 725 P Sbjct: 980 SAP 982 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P PPP P G PP PPP G P P G P PP PP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPP--PPPSPQPGCAGLPPPPPPPPP 748 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPP 713 PPP P G G PP P P+ G P P G P PP Sbjct: 713 PPPPPPPPGCAGLPPPPPSPQPGCAGLPP--PPPPPPPGCAGLPPPPP 758 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +3 Query: 570 PPPXPX--GXGFXGXGPPXPPPKXXPPG-XPXGGAXPXXXXGXKXFXPXPPRXPP 725 PPP P G PP PPP G P P G P PP P Sbjct: 680 PPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 PPP P GF G PP PPP P P P Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGP 230 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 609 GPPXPPPKXXPPGXPXGGAXP 671 G P PPP PPG P GGA P Sbjct: 193 GMPPPPPPPPPPGFP-GGAPP 212 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 36.7 bits (81), Expect = 0.026 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPP-----KXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 GPPP P G GPP PPP P P A P G P PP PP Sbjct: 150 GPPPPPPIAPATG-GPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 35.9 bits (79), Expect = 0.045 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 576 PXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P P G P PPP P G P P G + P PP PP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPP 1271 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 PPP P PP PPP PP P P P PP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 PPP P PP PPP PP P P P PP PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 P PPP P PP PPP PP P P P PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P PPP P P PPP PP P P P PP PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P PPP P P PPP PP P P P PP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 PPP P PP PPP PP P P P PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P PPP P PP PP PP P P P PP PP Sbjct: 374 PPPSPPPPPPPPP-PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P PPP P PP PP PP P P P PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP--PPPPPPPPP 418 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 P PPP P PP PPP PP A P Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPR 716 P PPP P PP PPP PP P P PPR Sbjct: 392 PPQPPPPPPPPP--PPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPR 442 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +3 Query: 612 PPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPPXXXXFXXXXXXXXXXXXXXXXP 791 PP PPP PP P P P PP PP P Sbjct: 365 PPPPPPP--PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Query: 792 KKXXXPPPP 818 PPPP Sbjct: 423 PPPPPPPPP 431 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P PPP P PP PPP P P P P PP PP Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/68 (26%), Positives = 19/68 (27%) Frame = +3 Query: 612 PPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPPXXXXFXXXXXXXXXXXXXXXXP 791 PP PPP PP P P P PP PP + P Sbjct: 100 PPYPPPPPYPP--PPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Query: 792 KKXXXPPP 815 PPP Sbjct: 158 PPLYPPPP 165 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 P PPP P PP PPP P P P P PP P Sbjct: 177 PPYPPPPNPPYP--PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 28.7 bits (61), Expect = 6.8 Identities = 22/88 (25%), Positives = 24/88 (27%), Gaps = 5/88 (5%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPP---KXXPPGXPXGGAXPXXXXGXKXFXPXP--PRXPPXXX 734 PPP P PP PPP PP P P + P P P PP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 735 XFXXXXXXXXXXXXXXXXPKKXXXPPPP 818 + PPPP Sbjct: 210 PYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/87 (24%), Positives = 22/87 (25%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPPXXXX 737 P PPP P PP PPP P P P P P PP Sbjct: 101 PYPPPPPYPPPPN-----PPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Query: 738 FXXXXXXXXXXXXXXXXPKKXXXPPPP 818 + P PPP Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPPPYPPP 182 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 7/45 (15%) Frame = +3 Query: 558 PXXGPP--PXPXGXGFXGXGPPXPPP-----KXXPPGXPXGGAXP 671 P GPP P P G G PP PPP PP P GG P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAP 700 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPPXXXXF 740 PPP P G G P PPP P GGA P P PP PP F Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLP-----GGAAPPPPPPIGGGAPPPP--PPGFGGF 710 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 33.5 bits (73), Expect = 0.24 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 9/61 (14%) Frame = +3 Query: 567 GPP--PXPXGXGFXGX--GPPXPPPKXXPPGX-----PXGGAXPXXXXGXKXFXPXPPRX 719 GPP P P G GPP PP PPG P G A P G P PP Sbjct: 875 GPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPPCP 934 Query: 720 P 722 P Sbjct: 935 P 935 Score = 31.5 bits (68), Expect = 0.96 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXP-PRXPP 725 GP P G G PP PP PPG P G P G P P+ PP Sbjct: 259 GPNGLPGPNGILG--PPGPPGDMGPPGLP-GPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +3 Query: 567 GPPPXPXGXGFXGX-------GPPXPPPKXXPPGXPXGGAXPXXXXG 686 GPP P G G GPP PP PPG P G P G Sbjct: 49 GPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPG 95 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXP-PRXPP 725 GP P G GPP PP PPG P G P G P P+ PP Sbjct: 174 GPNGLPGPNG--PLGPPGPPGDMGPPGLP-GPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 29.5 bits (63), Expect = 3.9 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 13/65 (20%) Frame = +3 Query: 567 GPPPXPXGXGFXG-----------XGPPXPPPKXXPPGXPXGGAXPXXXXG--XKXFXPX 707 GPP P G G+ G G P PP PPG P G P G P Sbjct: 322 GPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPG-PLGDVGPPGLPGPPGPQMPPG 380 Query: 708 PPRXP 722 PP P Sbjct: 381 PPGLP 385 Score = 29.5 bits (63), Expect = 3.9 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 13/65 (20%) Frame = +3 Query: 567 GPPPXPXGXGFXG-----------XGPPXPPPKXXPPGXPXGGAXPXXXXG--XKXFXPX 707 GPP P G G+ G G P PP PPG P G P G P Sbjct: 407 GPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPG-PLGDVGPPGLPGPPGPQMPPG 465 Query: 708 PPRXP 722 PP P Sbjct: 466 PPGLP 470 Score = 29.5 bits (63), Expect = 3.9 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 13/65 (20%) Frame = +3 Query: 567 GPPPXPXGXGFXG-----------XGPPXPPPKXXPPGXPXGGAXPXXXXG--XKXFXPX 707 GPP P G G+ G G P PP PPG P G P G P Sbjct: 492 GPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPG-PLGDVGPPGLPGPPGPQMPPG 550 Query: 708 PPRXP 722 PP P Sbjct: 551 PPGLP 555 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 567 GPPPXPXGXGFXGX----GPPXPPPKXXPPGXPXG 659 GPP P G G GP PP + PPG P G Sbjct: 465 GPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGG 499 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 567 GPPPXPXGXGFXGX----GPPXPPPKXXPPGXPXG 659 GPP P G G GP PP + PPG P G Sbjct: 550 GPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGG 584 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +3 Query: 567 GPPPXPXGXGFXGX----GPPXPPPKXXPPGXPXG 659 GPP P G G GP PP PPG P G Sbjct: 210 GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 244 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +3 Query: 567 GPPPXPXGXGFXGX----GPPXPPPKXXPPGXPXG 659 GPP P G G GP PP PPG P G Sbjct: 295 GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 329 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +3 Query: 567 GPPPXPXGXGFXGX----GPPXPPPKXXPPGXPXG 659 GPP P G G GP PP PPG P G Sbjct: 380 GPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGG 414 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXGPPPXPXGX-GFXGX-GPPXPPPKXXPPGXPXGGAXPXXXXGXK-XFXPXPPRXPP 725 P PP P G G G GPP P PPG P G P G P PP Sbjct: 437 PGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLP-GAPGPNGPPGINGPLGPPGEAGPP 494 Score = 28.3 bits (60), Expect = 8.9 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXGPPPXPXGX-GFXGX-GPPXPPPKXXPPGXPXGGAXPXXXXGXK-XFXPXPPRXPP 725 P PP P G G G GPP P PPG P G P G P PP Sbjct: 522 PGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLP-GAPGPNGPPGINGPLGPPGEAGPP 579 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 573 PPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 PP P F P PP PPG P A P G P PP PP Sbjct: 164 PPAPPAAPFMA---PAAPPAPPPPGAP--AAPPAPPFGGPPSAPPPPPAPP 209 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 573 PPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 PP P G PP PPP PP P P G P PP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGG----APPPPPPP 337 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 P G P P G PP PPP PP GGA P Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPP-PGDGGAPP 332 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPP 629 P PPP P G G PP PPP Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPP 713 PPP P PP PP PP P P G P PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPP--PPPPPGDGGAPPPPPPP 337 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKKXXXTPPXGXPXRPXKKK 326 KK KKKKK KKK +KK KKK + KKK Sbjct: 149 KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 188 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKKXXXTPPXGXPXRPXKKK 326 KK KKKKK KKK +KK KKK + KKK Sbjct: 150 KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 189 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKKXXXTPPXGXPXRPXKKK 326 KK KKKKK KKK +KK KKK + KKK Sbjct: 151 KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 190 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 202 PKKKXRKKKXXXKKKXLKKKXXKK 273 P KK +KKK KKK KKK KK Sbjct: 147 PTKKKKKKKKKKKKKKKKKKKKKK 170 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK KKKKK KKK +KK KK+ Sbjct: 169 KKKKKKKKKKKKKKKKKKKKKKE 191 >SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = +1 Query: 202 PKKKXRKKKXXXKKKXLKKKXXKKN 276 PKKK +KKK KKK KKK K N Sbjct: 343 PKKKKKKKKKKKKKKKKKKKKKKMN 367 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +3 Query: 210 KXKKKKKXXKKKXFEKKXXKKKXXXT 287 K KKKKK KKK +KK KKK T Sbjct: 344 KKKKKKKKKKKKKKKKKKKKKKMNST 369 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPK-XXPPGXPXGG 662 PPP P G G G PP PP + PP P GG Sbjct: 195 PPPPPPGPG--GIPPPPPPIRGGVPPPPPMGG 224 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +1 Query: 205 KKKXRKKKXXXKKKXLKKKXXKKN 276 KKK +KKK KKK KKK KKN Sbjct: 374 KKKKKKKKKKKKKKKKKKKKKKKN 397 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK KKKKK KKK +KK KKK Sbjct: 372 KKKKKKKKKKKKKKKKKKKKKKK 394 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK KKKKK KKK +KK KKK Sbjct: 373 KKKKKKKKKKKKKKKKKKKKKKK 395 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKKXXXTPPXGXP 305 KK KKKKK KKK +KK K T P P Sbjct: 376 KKKKKKKKKKKKKKKKKKKKKNSVELTMPAPGP 408 >SB_32355| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1358 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = +1 Query: 205 KKKXRKKKXXXKKKXLKKKXXKKN 276 KKK +KKK KKK KKK KKN Sbjct: 69 KKKKKKKKKKKKKKKKKKKKKKKN 92 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK KKKKK KKK +KK KKK Sbjct: 67 KKKKKKKKKKKKKKKKKKKKKKK 89 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK KKKKK KKK +KK KKK Sbjct: 68 KKKKKKKKKKKKKKKKKKKKKKK 90 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKKXXXTPPXGXP 305 KK KKKKK KKK +KK K T P P Sbjct: 71 KKKKKKKKKKKKKKKKKKKKKNSVELTMPAPGP 103 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 P GPPP P G PP PP PP P P Sbjct: 380 PTNGPPPPPPPTN--GPPPPPPPTNGPPPPPPPTNGPP 415 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 P GPPP P PP PPP PP G P Sbjct: 390 PTNGPPPPPPPTN---GPPPPPPPTNGPPSEGKCGRKP 424 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P PP P PP P K PP P G P P PP P Sbjct: 349 PPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 PPP P PP PPP PP P P P PP PP Sbjct: 365 PPPPPP----TNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP--PP 410 >SB_39066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 31.5 bits (68), Expect = 0.96 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 GPP P G G PP PPG P GGA P Sbjct: 265 GPPGHPGPPGVRGRRGKRGPP--GPPGPPNGGATP 297 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.5 bits (68), Expect = 0.96 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 PPP P G PP PP + PP P G+ P P PP PP Sbjct: 287 PPPPPS----RGAAPP-PPSRGAPPPPPSRGSAPPPPPARMGTAPPPP--PP 331 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P G P P G G PP PP PP P P G P P R P Sbjct: 349 PSMGMAPPPVG-GAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAP 403 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPX----PPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 PPP P PP PPP P GGA P P PP P Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 29.1 bits (62), Expect = 5.1 Identities = 26/97 (26%), Positives = 26/97 (26%), Gaps = 10/97 (10%) Frame = +3 Query: 558 PXXGPPPXPXGXGF--------XGXGPPXPPPKXXP--PGXPXGGAXPXXXXGXKXFXPX 707 P G PP P G G PP PPP P P GA P G P Sbjct: 300 PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAP-PPV 358 Query: 708 PPRXPPXXXXFXXXXXXXXXXXXXXXXPKKXXXPPPP 818 PP P PPPP Sbjct: 359 GGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXP 710 P G P P G PP PPP P G P G P P Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 6/58 (10%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPP------KXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 GPPP G GPP P P PP G P G F P PP P Sbjct: 385 GPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 582 PXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXP 704 P G G G PP PPP PP P P G F P Sbjct: 784 PEGEGVGGITPPPPPPPPPPP--PEDLIIPLPRRGSDLFAP 822 >SB_58047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 9/38 (23%) Frame = +3 Query: 573 PPXPXGXGFXGXG---------PPXPPPKXXPPGXPXG 659 PP P G G G G PP PP PPG P G Sbjct: 190 PPGPPGPGLVGSGSGAGAVIAGPPGPPGPPGPPGPPGG 227 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 570 PPPX--PXGXGFXGXGPPXPPPKXXPPGXPXG-GAXPXXXXGXKXFXPXPPRXPP 725 PPP P F GPP PP + P P A P + P PP PP Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP--PP 334 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPP 644 PPP P GPP PPP PP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPP 381 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXPXG 659 GPPP P G PP P PP P G Sbjct: 193 GPPPPPHSR--HGSAPPPPERSSGPPPPPPG 221 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/53 (28%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPR 716 P PPP G G PPP+ G G P + + P P R Sbjct: 161 PRERPPPPSYSSERVGYGDKYPPPERSYSGGERGYGPPPARSADRGYGPLPDR 213 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXP--PGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P G P G + GPP P P PG P G P G + R PP Sbjct: 78 PPRGHPMRGRGAPYGRGGPPSRGPPRGPPLPGPPRRGPPPDRDSGYGGYGDRYDRPPP 135 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXGPPPX-PXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPP 725 P GPPP G G G PPP PP P P + + P PP Sbjct: 111 PRRGPPPDRDSGYGGYGDRYDRPPPDRRPP-PPDRSGYPPPRDYDRGYADRPRERPP 166 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 594 GFXGXGPPXPPPKXXP---PGXPXG-GAXPXXXXGXKXFXPXPPRXPP 725 G G GPP PP+ P G P G G P P PPR P Sbjct: 68 GGYGGGPPRGPPRGHPMRGRGAPYGRGGPPSRGPPRGPPLPGPPRRGP 115 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +3 Query: 567 GPPPXPXGXGFXGX--GPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 GPP P G+ G P PP PPG P G P G P PP P Sbjct: 1801 GPPGPPGAIGWKGNPGNPAGPPGLDGPPG-PPGPQGPKGWPG----VPGPPGPP 1849 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXF--XPXPPRXPP 725 PPP P G G P P P P G P G + P P PP Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 570 PPPX--PXGXGFXGXGPPXPPPKXXPPGXPXG-GAXPXXXXGXKXFXPXPPRXPP 725 PPP P F GPP PP + P P A P + P PP PP Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP--PP 246 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPP 644 PPP P GPP PPP PP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPP 293 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXPXG 659 GPPP P G PP P PP P G Sbjct: 105 GPPPPPHSR--HGSAPPPPERSSGPPPPPPG 133 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP--XXXXGXKXFXPXPPRXPP 725 P GPPP G G PP P + P G GA P G P P PP Sbjct: 2136 PAMGPPPM--GSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPP 2191 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXP 653 G PP P G G PP PPP PG P Sbjct: 651 GIPPPPPGGGMF-PPPPPPPPGGGVPGPP 678 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPP 629 PPP P G G G PP PPP Sbjct: 665 PPPPPPGGGVPG--PPKPPP 682 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPP 644 P PPP P G PP PPP P Sbjct: 299 PAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 205 KKKXRKKKXXXKKKXLKKKXXKKN 276 +KK +KKK KKK KKK KKN Sbjct: 16 EKKRKKKKQKKKKKKKKKKKKKKN 39 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 205 KKKXRKKKXXXKKKXLKKKXXKKN 276 +KK ++KK KKK KKK KKN Sbjct: 19 RKKKKQKKKKKKKKKKKKKKNKKN 42 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXP 653 PPP P F PP PPP PP P Sbjct: 297 PPPAPPLPNFTSPSPPPPPP--LPPAMP 322 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 G PP G G PP PP PPG P G P Sbjct: 263 GMPPQ-YGPGRRDMPPPGAPPGMLPPGMPPHGMPP 296 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/71 (23%), Positives = 19/71 (26%) Frame = +3 Query: 603 GXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXPPXXXXFXXXXXXXXXXXXXX 782 G G PP + PG P GG P PP P Sbjct: 208 GMGKRFPPGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQ 267 Query: 783 XXPKKXXXPPP 815 P + PPP Sbjct: 268 YGPGRRDMPPP 278 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXP 653 PPP P PP PPP PP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +3 Query: 567 GPP-PXPXGXGFXGXGPPXPPPKXXPPGXPXGG--AXPXXXXGXKXFXPXPPRXPP 725 GPP P P G GPP PP PP G P P PP PP Sbjct: 435 GPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPP 490 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 G PP P PP PPP P G P P PP P Sbjct: 267 GHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEP 318 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 573 PPXPXGXGFXGXGPPXPPPKXXPPGXPXG 659 PP P G F GP PPP PP P G Sbjct: 411 PPGPHGPPF---GPRGPPPHGGPPRGPMG 436 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/55 (34%), Positives = 20/55 (36%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 P PP G G G GP PP+ P G P P G PPR P Sbjct: 383 PRGMPPKEDWGPGPRGMGPGMGPPR--PMGPPGPHGPPFGPRGPPPHG-GPPRGP 434 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 603 GXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 G PP PPP PP P P F P PP P Sbjct: 461 GQAPPPPPPPPPPPPPP----PPPPPPPPPPFPPPPPPTP 496 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 29.5 bits (63), Expect = 3.9 Identities = 21/83 (25%), Positives = 25/83 (30%) Frame = -1 Query: 817 GGGGXXFFLGXXXXXXXXXXXXXXXXKXXXXGGXLGGXGLXXFXPXFXXGXAPPFGXPGG 638 GGGG + G G +GG + P G +G GG Sbjct: 181 GGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGG 240 Query: 637 XXLGGGXGGPXPXXPFPXGXGGG 569 GGG G P GGG Sbjct: 241 GGGGGGYSGGGSGNPHYYACGGG 263 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPP 629 PPP P GF PP PPP Sbjct: 64 PPPPPPRRGFYDDYPPPPPP 83 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXP 653 P GPPP G G PP PPP P P Sbjct: 211 PMGGPPPMGGPPG--GYPPPPPPPGAGDPAYP 240 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.1 bits (62), Expect = 5.1 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPX---PPPKXXPPG-XPXGGAXPXXXXGXKXFXP--XPPRX 719 P PP G G PP PPP PPG P G P G P PP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 720 PP 725 PP Sbjct: 284 PP 285 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 6/58 (10%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPX------PPPKXXPPGXPXGGAXPXXXXGXKXFXPXPP 713 P PPP P G G+ PP PPP P G P P P PP Sbjct: 589 PGTYPPPHPSG-GYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQHPPPP 645 >SB_14664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK KK KK KKK +KK KKK Sbjct: 22 KKKKKSKKKIKKKKKKKKKKKKK 44 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK K KKK KKK +KK KKK Sbjct: 23 KKKKSKKKIKKKKKKKKKKKKKK 45 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +3 Query: 210 KXKKKKKXXKKKXFEKKXXKKKXXXTPPXGXPXRPXKKK 326 K KKKKK KK +KK KKK G K+K Sbjct: 20 KIKKKKKSKKKIKKKKKKKKKKKKKKEEEGKEVEESKRK 58 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +3 Query: 567 GPPPXPXGXGF----XGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXP 710 GPPP G G+ G G PP PPG GG P G P P Sbjct: 513 GPPPPGAGQGWGQPPPGAGQGGGPP---PPGAGQGGGPPPPGAGQGWGQPPP 561 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPPK-XXPPGXPXGGAXPXXXXGXKXFXPXP 710 G P P G G G PP + PPG GG P G P P Sbjct: 566 GGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQGWGLPPP 614 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +3 Query: 567 GPPPXPXGXGFXGXGPPXPPP----KXXPPGXPXGGAXPXXXXGXKXFXPXP 710 GPPP G G GPP P PPG GG P G P P Sbjct: 502 GPPPPGAG---QGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP 550 >SB_4894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKKXXXTPPXGXP 305 KK +KKK+ K+K +KK K + +PP P Sbjct: 65 KKHQKKKEKEKEKEKDKKKKKSETPSSPPPKKP 97 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = -1 Query: 670 GXAPPFGXPGGXXLGGGXGGPXPXXPF-----PXGXGGGPXXG 557 G PP G P G GG GGP P P G GGG G Sbjct: 493 GGGPPRGGPRGGR-GGSRGGPPRGAPRGRSGPPRGRGGGDFGG 534 >SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2337 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 202 PKKKXRKKKXXXKKKXLKKKXXKK 273 PKKK +KKK KKK KK+ K Sbjct: 1137 PKKKKKKKKKKKKKKKKKKRAPPK 1160 >SB_36647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 207 KKXKKKKKXXKKKXFEKKXXKKK 275 KK +KKKK +KK +KK KKK Sbjct: 7 KKKQKKKKKKRKKKKQKKQKKKK 29 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 567 GPPPXPXGXGFXG-XGPPXPPPKXXPPGXPXGG 662 GPP P GF G GP PP PG P G Sbjct: 1073 GPPGPPGYPGFKGYRGPQGPPGIAGEPGPPGIG 1105 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -1 Query: 724 GGXLGGXGLXXFXPXFXXGXAPPFGXP--GGXXLGGGXGGPXPXXPFPXGXGGGPXXG 557 GG +GG G+ F G G GG +GGG GG GGG G Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAG 1834 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +3 Query: 573 PPXPXGXGFXGXGPPXPPPKXXPP-GXPXGGAXPXXXXGXKXFXPXP-PRXPP 725 PP P PP PPP PP P P K P P P PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 570 PPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXPXXXXGXKXFXPXPPRXP 722 PPP P P PPP P P A P P PP P Sbjct: 50 PPPPPPSP--PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPP 644 P PPP P G PP PK PP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPP 578 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 612 PPXPPPKXXPPGXPXGG 662 PP PPP PP P GG Sbjct: 70 PPPPPPPPLPPPPPSGG 86 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 612 PPXPPPKXXPPGXPXGG 662 PP PPP PP P GG Sbjct: 294 PPPPPPPPLPPPPPSGG 310 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 558 PXXGPPPXPXGXGFXGXGPPXPPPKXXPPGXPXGGAXP 671 P P P P P PPP PP P G+ P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.148 0.500 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,396,437 Number of Sequences: 59808 Number of extensions: 228892 Number of successful extensions: 1862 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1071 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -