BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C20 (1146 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 43 5e-04 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.003 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.009 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 38 0.015 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.020 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.020 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.035 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.035 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 37 0.035 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 35 0.11 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 35 0.11 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 35 0.11 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 33 0.33 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 33 0.43 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 33 0.57 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 32 0.75 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 32 0.75 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.99 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.99 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.3 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 1.3 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 31 1.3 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.3 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 2.3 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 2.3 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 31 2.3 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.3 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 3.0 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 30 3.0 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.0 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.0 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 30 4.0 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.0 SB_45874| Best HMM Match : TIR (HMM E-Value=0.43) 23 5.3 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 7.0 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.0 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 29 7.0 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.0 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.0 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 9.2 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.2 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.2 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 43.2 bits (97), Expect = 4e-04 Identities = 30/121 (24%), Positives = 31/121 (25%), Gaps = 2/121 (1%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXP-PPPPXPPAXXXXXXXXXGXXXXXWX 831 P P P PPPP P PPPP PP + Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 832 XPPPXP-PXPXXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXPPXXX 1008 PP P P P PP PP P P PP PP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 1009 P 1011 P Sbjct: 210 P 210 Score = 39.5 bits (88), Expect = 0.005 Identities = 30/122 (24%), Positives = 30/122 (24%), Gaps = 2/122 (1%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXXXXXWXX 834 P P P PPPP P PP PP PP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPY--PPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Query: 835 PPPXPPX--PXXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXPPXXX 1008 PP PP P PP PP P P P PP Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Query: 1009 PP 1014 PP Sbjct: 214 PP 215 Score = 37.9 bits (84), Expect = 0.015 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPP 925 PP P PP PP + PPP PP PP P A P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPN---P 231 Query: 926 PXXPPRXP 949 P PP P Sbjct: 232 PYPPPPNP 239 Score = 37.5 bits (83), Expect = 0.020 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPP 925 PP P P PP S P P PP PP P PP Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP 176 Query: 926 PXXPPRXPPXXXXXP 970 P PP P P Sbjct: 177 PPYPPPPNPPYPPPP 191 Score = 37.1 bits (82), Expect = 0.026 Identities = 33/153 (21%), Positives = 33/153 (21%), Gaps = 1/153 (0%) Frame = +1 Query: 481 NXPXPPQXX*XXKXPAPXXXXPXXXXXXSXGGXKXXVXXXXXXXSPXXXXXGGXXXXXPX 660 N P PP P P P P P Sbjct: 91 NPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPP 150 Query: 661 PXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXXXXXWXXPP 840 P P PPPP P PP PP PP PP Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP----NPPP 206 Query: 841 PXPP-XPXXXXXXXXXXSGXXXXXPPXXPPXXP 936 P PP P PP PP P Sbjct: 207 PNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 36.7 bits (81), Expect = 0.035 Identities = 32/127 (25%), Positives = 33/127 (25%), Gaps = 7/127 (5%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPP--PXPPAXXXXXXXXXGXXXXX- 825 P P P PPPP P PPPP P PP+ Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNP----PYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Query: 826 WXXPPPXPPXPXXXXXXXXXXSGXXXXXPPXXPPXXPXAXX----PXXXXAXPPXXXXKX 993 PPP PP P PP P P P PP Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPN 219 Query: 994 PPXXXPP 1014 PP PP Sbjct: 220 PPYPPPP 226 Score = 33.5 bits (73), Expect = 0.33 Identities = 25/104 (24%), Positives = 25/104 (24%), Gaps = 2/104 (1%) Frame = +3 Query: 696 PPPXXXXXXXXPXXXXXPPX--PXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXG 869 PPP P PP P PP PPP PP Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPN 192 Query: 870 XXXXXXXGAXXXPPXXXPPPPPXRXXPXPXXXXPXXXXXXXPSP 1001 A PP P PPP P P P P Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 31.5 bits (68), Expect = 1.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXX-PPPXXPPRXPPXXXXXP 970 PPP PP PP P PPP PP PP P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 29.5 bits (63), Expect = 5.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 834 PPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPPXRXXPXPXXXXPXXXXXXXPSP 1001 PPP PPP A PP P PPP P P P P Sbjct: 105 PPPYPPPP---NPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 42.7 bits (96), Expect = 5e-04 Identities = 32/101 (31%), Positives = 32/101 (31%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GGG GG G G G GG GG GGG G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Query: 867 XAGGXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXGXGG 745 A G GG GGG GG GG G GG Sbjct: 842 YADGDGGGGGGGG-------GGGGGGGGGGGGGGGGGGGGG 875 Score = 38.7 bits (86), Expect = 0.009 Identities = 33/118 (27%), Positives = 33/118 (27%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GG GG G G GG GG GGG G Sbjct: 772 GGGDGGDGGGGG-------------DGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Query: 867 XAGGXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXGXGGXXPXXXXXXXXXXXGGG 694 GG GG GGG GG GG G GG GGG Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 32.7 bits (71), Expect = 0.57 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = -2 Query: 857 GXGGXGGGXXQXXXXXPXXXXXXXXXAGGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXX 678 G GG GGG GG GGGGG G GGG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGD 846 Query: 677 XRGXXGXG 654 G G G Sbjct: 847 GGGGGGGG 854 Score = 32.3 bits (70), Expect = 0.75 Identities = 29/115 (25%), Positives = 29/115 (25%) Frame = -2 Query: 998 GGXXXXXXGGXAXXXXGXXAXGXXGGXXGGXXXXXPXXXXXXXXXXXGXGGXGGGXXQXX 819 GG GG G G GG GG G GG GGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG--- 827 Query: 818 XXXPXXXXXXXXXAGGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG G GGG GGGG G G G Sbjct: 828 --------GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 30.7 bits (66), Expect = 2.3 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -2 Query: 848 GXGGGXXQXXXXXPXXXXXXXXXAGGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRG 669 G GGG GG GGGGG G GGGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 668 XXGXG 654 G G Sbjct: 829 GYGDG 833 Score = 29.1 bits (62), Expect = 7.0 Identities = 26/108 (24%), Positives = 26/108 (24%), Gaps = 1/108 (0%) Frame = -2 Query: 974 GGXAXXXXGXXAXGXXGGXXGGXXXXXPXXXXXXXXXXXGXGGXGGGXXQXXXXXPXXXX 795 GG G G GG GG G G GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 794 XXXXXAG-GXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 G G GGG G GGGG G G G Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = +1 Query: 637 GXXXXXPXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXX 816 G P P P PPPP P PPPPP PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 817 XXXWXXPPPXPP 852 PPP PP Sbjct: 420 PPPPPPPPPPPP 431 Score = 40.3 bits (90), Expect = 0.003 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPP 925 PP P PP PP PPP PP PP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP---PPPPPPAPP 421 Query: 926 PXXPPRXPP 952 P PP PP Sbjct: 422 PPPPPPPPP 430 Score = 37.9 bits (84), Expect = 0.015 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPP 925 PP P PP PP PPP PP PP P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP---------PPPPPAPPPP 423 Query: 926 PXXPPRXPP 952 P PP PP Sbjct: 424 PPPPPPPPP 432 Score = 37.5 bits (83), Expect = 0.020 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 835 PPPXPPXPXXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXPPXXXPP 1014 PPP PP P PP PP P P PP PP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 36.7 bits (81), Expect = 0.035 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 PPP PP PP+ P PPP PP PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 36.7 bits (81), Expect = 0.035 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 PPP PP PP+ P PPP PP PP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 36.3 bits (80), Expect = 0.046 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 835 PPPXPPXPXXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXPPXXXPP 1014 PPP PP S PP PP P P PP PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 35.9 bits (79), Expect = 0.061 Identities = 26/89 (29%), Positives = 27/89 (30%) Frame = +1 Query: 748 PXPPPPPXPPAXXXXXXXXXGXXXXXWXXPPPXPPXPXXXXXXXXXXSGXXXXXPPXXPP 927 P PPPPP PP+ PPP PP P PP PP Sbjct: 367 PPPPPPPPPPSPPPPPPP-----------PPPSPPPPPQPP-------------PPPPPP 402 Query: 928 XXPXAXXPXXXXAXPPXXXXKXPPXXXPP 1014 P P PP PP PP Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 35.9 bits (79), Expect = 0.061 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +3 Query: 747 PPXPXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXGXXXXXXXGAXXXPPXXXPP 926 PP P PP PPP PPP A PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 927 PPP 935 PPP Sbjct: 430 PPP 432 Score = 35.9 bits (79), Expect = 0.061 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +3 Query: 834 PPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPPXRXXPXPXXXXPXXXXXXXPSPXXA 1010 PP PPP PP PPPPP P P P P P A Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 33.9 bits (74), Expect = 0.25 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPA 780 P P PPPP P PPPPP PPA Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 33.5 bits (73), Expect = 0.33 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 PPP PP PP P + P P PP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 33.5 bits (73), Expect = 0.33 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 PPP PP PP P PP PP PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 33.5 bits (73), Expect = 0.33 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 PPP PP P P PPP PP PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 33.1 bits (72), Expect = 0.43 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +3 Query: 696 PPPXXXXXXXXPXXXXXPPXPXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXGXX 875 PPP P PP P PP + PPP PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP-------------PPPPPPPPPPPPPP 413 Query: 876 XXXXXGAXXXPPXXXPPPPPXRXXPXP 956 PP PPPP R P Sbjct: 414 PPPPPAPPPPPPPPPPPPPALRLACAP 440 Score = 29.9 bits (64), Expect = 4.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 906 PPXXXPPPPPXRXXPXPXXXXPXXXXXXXPSP 1001 PP PPPPP P P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 38.7 bits (86), Expect = 0.009 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 6/78 (7%) Frame = +2 Query: 737 GXXPPXPXPPXXR---PPXXXXXXXXXGXXXXSGXXPPPXPPX---PPAXXXXXXXXRGX 898 G PP P PP PP G PPP PP P Sbjct: 917 GSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Query: 899 PGAXXXXPPPXXPPRXPP 952 PG PPP PP PP Sbjct: 977 PGGSAPPPPPPPPPPPPP 994 Score = 33.1 bits (72), Expect = 0.43 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +2 Query: 695 PPPXXXXXXXXSXXGXXPPXPXPPXXR-PPXXXXXXXXXGXXXXSGXXPPPXPPXPP 862 PP G PP P PP PP S PPP PP PP Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 32.3 bits (70), Expect = 0.75 Identities = 22/82 (26%), Positives = 22/82 (26%) Frame = +3 Query: 696 PPPXXXXXXXXPXXXXXPPXPXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXGXX 875 PPP P P PP G PP PPP Sbjct: 924 PPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG---- 979 Query: 876 XXXXXGAXXXPPXXXPPPPPXR 941 A PP PPPPP R Sbjct: 980 -----SAPPPPPPPPPPPPPMR 996 Score = 31.5 bits (68), Expect = 1.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 834 PPPXPPPXXXXGXXXXXXXGAXXXPPXXX----PPPPPXRXXPXP 956 PPP PPP G GA PP PPPPP P P Sbjct: 953 PPPPPPPG---GSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 37.9 bits (84), Expect = 0.015 Identities = 30/114 (26%), Positives = 30/114 (26%), Gaps = 8/114 (7%) Frame = +1 Query: 694 PPPPXXXXXXXXXXXXXXPXPPP-----PPXPPAXXXXXXXXXGXXXXXWXXPPPX---P 849 PPPP P PPP PP PPA PPP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 850 PXPXXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXPPXXXP 1011 P P G PP PP P PP PP P Sbjct: 347 PPPSMGMAPPPV--GGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 35.1 bits (77), Expect = 0.11 Identities = 25/92 (27%), Positives = 27/92 (29%) Frame = +3 Query: 696 PPPXXXXXXXXPXXXXXPPXPXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXGXX 875 PPP P P P A +G PPP PPP Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGR--- 384 Query: 876 XXXXXGAXXXPPXXXPPPPPXRXXPXPXXXXP 971 + PP PPPPP R P P P Sbjct: 385 ---PPSSLGNPP---PPPPPGRGAPPPGPMIP 410 Score = 33.1 bits (72), Expect = 0.43 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +3 Query: 825 LGXPPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPPXRXXPXPXXXXPXXXXXXXPSP 1001 +G PP PPP GA P PPP P P P P P Sbjct: 322 MGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 31.5 bits (68), Expect = 1.3 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +3 Query: 825 LGXPPPXPPPXXXXGXXXXXXXGAXXXPPXXX--PPPPPXRXXPXPXXXXPXXXXXXXPS 998 LG PP PP GA PP PPPPP R P P P Sbjct: 283 LGIQPPPPPSRG--AAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Query: 999 P 1001 P Sbjct: 341 P 341 Score = 31.1 bits (67), Expect = 1.7 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 1/85 (1%) Frame = +2 Query: 689 AXPPPXXXXXXXXSXXGXXPPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAX 868 A PPP S PP P PP G G PPP PP P Sbjct: 325 APPPPPP------SRSSQRPPPPSRGAPPPPSMGMAPPPVG-----GAAPPPPPPPPVGG 373 Query: 869 XXXXXXX-RGXPGAXXXXPPPXXPP 940 G P + PPP PP Sbjct: 374 PPPPPPPIEGRPPSSLGNPPPPPPP 398 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.5 bits (83), Expect = 0.020 Identities = 30/103 (29%), Positives = 31/103 (30%), Gaps = 3/103 (2%) Frame = -1 Query: 1044 GXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXG---GGXXXXAPGXPRXXXXX 874 G GGG GG G G + G GG GG G GG G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Query: 873 XXXAGGXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXGXGG 745 GG G GGG GG GG G GG Sbjct: 322 GATGGGVGATGGGGGATGGGGGVTGGGGGATGG--GGGPGSGG 362 Score = 36.3 bits (80), Expect = 0.046 Identities = 30/106 (28%), Positives = 31/106 (29%), Gaps = 3/106 (2%) Frame = -1 Query: 1044 GXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXG---GGXXXXAPGXPRXXXXX 874 G GGG GG G G + G GG GG G GG G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGG 314 Query: 873 XXXAGGXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXGXGGXXP 736 GG G GGG GG GG GG P Sbjct: 315 GATGGGGGATGGGVGATGGGGGATGGGGGVTGG--GGGATGGGGGP 358 Score = 32.3 bits (70), Expect = 0.75 Identities = 28/100 (28%), Positives = 29/100 (29%), Gaps = 5/100 (5%) Frame = -1 Query: 1038 GGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGX---XGGGXXXXAPGXPRXXXXXXX 868 GGG GG G G + G GG GG GGG G Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 302 Query: 867 XAGGXG--GXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXG 754 GG G G GGG GG GG G Sbjct: 303 TGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Score = 31.1 bits (67), Expect = 1.7 Identities = 32/120 (26%), Positives = 33/120 (27%), Gaps = 2/120 (1%) Frame = -1 Query: 1047 GGXGGGXX-GGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXX 871 G GGG GG G G + G GG GG GGG G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG--GGGATGGGGGATGGGGGAT 296 Query: 870 XXAGGXGGXGGGXXPXXXXXPXXXXXXXXXG-GRXXGGXGXGGXXPXXXXXXXXXXXGGG 694 GG G GGG G G GG G G GGG Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGG 356 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 37.5 bits (83), Expect = 0.020 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -1 Query: 1044 GXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXX 865 G GGG GG G G F G GG GG GGG G Sbjct: 1775 GGGGGM-GGGGMAAGGGEFGGGEGMGGGGMAGGG-GGMGGGGGGMGGGGEGMGAAGGGMG 1832 Query: 864 AGGXGGXGGG 835 AGG GG GG Sbjct: 1833 AGGEGGGAGG 1842 Score = 36.7 bits (81), Expect = 0.035 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 G GGG G G G G GG GG GGG A G Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG---GGMGAGG 1835 Query: 867 XAGGXGGXGGG 835 GG GG GGG Sbjct: 1836 EGGGAGGGGGG 1846 Score = 31.9 bits (69), Expect = 0.99 Identities = 23/88 (26%), Positives = 23/88 (26%) Frame = -2 Query: 1010 GXXXGGXXXXXXGGXAXXXXGXXAXGXXGGXXGGXXXXXPXXXXXXXXXXXGXGGXGGGX 831 G GG GG G G G GG G G GGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 830 XQXXXXXPXXXXXXXXXAGGXGGGGGXG 747 AGG GGG G G Sbjct: 1816 GMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 30.7 bits (66), Expect = 2.3 Identities = 23/71 (32%), Positives = 23/71 (32%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GGG GG G G G G GG GGG G Sbjct: 1756 GGFGGGGGGG-GMGGGGGMAGGGGGMGGGGMAAG--GGEFGGGEGMGGGGMAGGGGGMGG 1812 Query: 867 XAGGXGGXGGG 835 GG GG G G Sbjct: 1813 GGGGMGGGGEG 1823 Score = 29.9 bits (64), Expect = 4.0 Identities = 25/87 (28%), Positives = 25/87 (28%) Frame = -2 Query: 1013 GGXXXGGXXXXXXGGXAXXXXGXXAXGXXGGXXGGXXXXXPXXXXXXXXXXXGXGGXGGG 834 GG GG GG G A G G GG G GG GGG Sbjct: 1763 GGGGMGGGGGMAGGGGGMGGGGMAAGG--GEFGGGEGMGGGGMAGGGGGMGGGGGGMGGG 1820 Query: 833 XXQXXXXXPXXXXXXXXXAGGXGGGGG 753 GG GGGGG Sbjct: 1821 GE--GMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 28.7 bits (61), Expect = 9.2 Identities = 21/82 (25%), Positives = 21/82 (25%) Frame = -1 Query: 990 FXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGGXXPXXXXX 811 F G GG GG G G A G GG G GGG Sbjct: 1758 FGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGM 1817 Query: 810 PXXXXXXXXXGGRXXGGXGXGG 745 GG G GG Sbjct: 1818 GGGGEGMGAAGGGMGAGGEGGG 1839 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 36.7 bits (81), Expect = 0.035 Identities = 22/70 (31%), Positives = 24/70 (34%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GGG G G G + G G GG G G A G Sbjct: 43 GGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Query: 867 XAGGXGGXGG 838 +GG GG GG Sbjct: 103 GSGGVGGNGG 112 Score = 31.5 bits (68), Expect = 1.3 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG G G G G G G G GG GG A G Sbjct: 41 GGGGNGGGAGNGVGAGG-CGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNV 99 Query: 867 XAGGXGGXGG 838 GG GG GG Sbjct: 100 GGGGSGGVGG 109 Score = 29.1 bits (62), Expect = 7.0 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GGG G G G + GG GG G G G Sbjct: 37 GGVGGGGGNGGGA---GNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGA 93 Query: 867 XAGGXGGXGG 838 AGG G GG Sbjct: 94 GAGGNVGGGG 103 Score = 28.7 bits (61), Expect = 9.2 Identities = 25/89 (28%), Positives = 26/89 (29%) Frame = -2 Query: 1013 GGXXXGGXXXXXXGGXAXXXXGXXAXGXXGGXXGGXXXXXPXXXXXXXXXXXGXGGXGGG 834 GG GG GG A G G GG GG G GG G G Sbjct: 35 GGGGVGGGGGN--GGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGG-------GGGGAGNG 85 Query: 833 XXQXXXXXPXXXXXXXXXAGGXGGGGGXG 747 +GG GG GG G Sbjct: 86 GAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 36.7 bits (81), Expect = 0.035 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPP 925 PP P PP PP G G PP PP P G PGA PP Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIP----GYPGA-PAGPP 1716 Query: 926 PXXPPRXPP 952 P PP Sbjct: 1717 GRDGPMGPP 1725 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 36.7 bits (81), Expect = 0.035 Identities = 26/101 (25%), Positives = 26/101 (25%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GG GG G G G G GG GGG G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGA 103 Query: 867 XAGGXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXGXGG 745 GG G GG GG G GG Sbjct: 104 TGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGG 144 Score = 30.3 bits (65), Expect = 3.0 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 3/72 (4%) Frame = -1 Query: 1044 GXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGG-GXXXXAPGXPRXXXXXXX 868 G GGG GG G G + G GG GG G G A G Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGG 157 Query: 867 XA--GGXGGXGG 838 A GG G GG Sbjct: 158 GATGGGGGATGG 169 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 35.1 bits (77), Expect = 0.11 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = +2 Query: 695 PPPXXXXXXXXSXXGXXPPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXX 874 PPP S PP P PP PP PPP PP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPP---PPLLSGTLPMP---------PPPPPPPPGCAGL 725 Query: 875 XXXXXRGXPGAXXXXPPPXXPP 940 PG PPP PP Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPP 747 Score = 34.3 bits (75), Expect = 0.19 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +3 Query: 696 PPPXXXXXXXXPXXXXXPPXPXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXGXX 875 PPP PP P PP + G PPP P P Sbjct: 680 PPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP----- 734 Query: 876 XXXXXGAXXXPPXXXPPPPPXRXXPXP 956 G PP PPPP P P Sbjct: 735 -----GCAGLPPPPPPPPPGCAGLPPP 756 Score = 32.7 bits (71), Expect = 0.57 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = +1 Query: 694 PPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXXXXXWXXPPPXPPXPXXXXX 873 PPPP P PPPPP P G PPP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPP--------LLSGTLPMPPPPPPPPPGCAGLPPP 728 Query: 874 XXXXXSGXXXXXPPXXPPXXPXAXXP 951 G PP PP A P Sbjct: 729 PPSPQPGCAGLPPPPPPPPPGCAGLP 754 Score = 32.7 bits (71), Expect = 0.57 Identities = 25/87 (28%), Positives = 26/87 (29%) Frame = +1 Query: 754 PPPPPXPPAXXXXXXXXXGXXXXXWXXPPPXPPXPXXXXXXXXXXSGXXXXXPPXXPPXX 933 PPPPP P PPP PP P SG PP PP Sbjct: 677 PPPPPPLPVIEGSSLSVP---------PPPPPPPPPLL-------SGTLPMPPPPPPPPP 720 Query: 934 PXAXXPXXXXAXPPXXXXKXPPXXXPP 1014 A P + P PP PP Sbjct: 721 GCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 32.3 bits (70), Expect = 0.75 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 1/69 (1%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPP-PPXPPAXXXXXXXXXGXXXXXWX 831 P P P PP P PPP PP PP Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAG 738 Query: 832 XPPPXPPXP 858 PPP PP P Sbjct: 739 LPPPPPPPP 747 Score = 29.1 bits (62), Expect = 7.0 Identities = 17/59 (28%), Positives = 17/59 (28%), Gaps = 5/59 (8%) Frame = +1 Query: 616 PXXXXXGGXXXXXPXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPP-----PPXPP 777 P G P P P PPPP P PPP PP PP Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 35.1 bits (77), Expect = 0.11 Identities = 27/93 (29%), Positives = 28/93 (30%) Frame = -1 Query: 1038 GGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAG 859 GGG GG G G + G GG GG GGG G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG----------GYGGG 194 Query: 858 GXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGG 760 G GG GGG GGR GG Sbjct: 195 GYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 34.7 bits (76), Expect = 0.14 Identities = 23/71 (32%), Positives = 23/71 (32%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 G GGG G G GR G GG GG GGG Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS 206 Query: 867 XAGGXGGXGGG 835 GG GG GGG Sbjct: 207 GYGGGGGYGGG 217 Score = 33.9 bits (74), Expect = 0.25 Identities = 28/99 (28%), Positives = 28/99 (28%), Gaps = 1/99 (1%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGX-RGGXXGGGXXXXAPGXPRXXXXXX 871 GG GGG GG G G G G RGG GG G Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Query: 870 XXAGGXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXG 754 GG G GGG GG GG G Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 31.5 bits (68), Expect = 1.3 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 1/76 (1%) Frame = -1 Query: 969 GXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXG-GGXXPXXXXXPXXXXX 793 G GG GG GGG + G R GG G G GG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 792 XXXXGGRXXGGXGXGG 745 GG GG G GG Sbjct: 183 GGGHGGGGYGGGGYGG 198 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.1 bits (77), Expect = 0.11 Identities = 32/126 (25%), Positives = 34/126 (26%) Frame = +1 Query: 637 GXXXXXPXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXX 816 G P P + PPPP P PPPPP PA Sbjct: 92 GVEAPTPTPMVAQSVAPTPPPPPRAPETPSQA-----PSPPPPPTSPATRAPPPPPP--I 144 Query: 817 XXXWXXPPPXPPXPXXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXP 996 PPP PP +G PP P A A PP P Sbjct: 145 APATGGPPPPPPIAPA--------TGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPP 196 Query: 997 PXXXPP 1014 P PP Sbjct: 197 PPPPPP 202 Score = 34.3 bits (75), Expect = 0.19 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 828 GXPPPXPP--PXXXXGXXXXXXXGAXXXPPXXXPPPPPXRXXPXP 956 G PPP PP P A PP PPPPP P P Sbjct: 162 GGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 Score = 33.9 bits (74), Expect = 0.25 Identities = 26/96 (27%), Positives = 26/96 (27%), Gaps = 4/96 (4%) Frame = +2 Query: 695 PPPXXXXXXXXSXXGXXPPXPXPPXXR--PPXXXXXXXXXGXXXXSGXXPPPX--PPXPP 862 PPP S PP P P R PP G P PP PP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 863 AXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 P A PPP P PP P Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 28.7 bits (61), Expect = 9.2 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPP 777 P P P P P P PPPPP PP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.5 bits (73), Expect = 0.33 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPR 889 GG GGG GG G G G GG GG GGG G R Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 32.7 bits (71), Expect = 0.57 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGG 919 GG GGG GG G G G GG GG GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 31.1 bits (67), Expect = 1.7 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPR 889 GG GGG GG G G G GG G GGG G R Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRAR 117 Score = 30.7 bits (66), Expect = 2.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 969 GXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGG 835 G GG GG GGG G GG GG GGG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 30.3 bits (65), Expect = 3.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 951 GGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGG 835 GG GG GGG G GG GG GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 29.9 bits (64), Expect = 4.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 969 GXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGG 835 G GG GG GGG G GG GG GGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 33.1 bits (72), Expect = 0.43 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPG 898 GG GGG GG G G G GG GG GGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 30.3 bits (65), Expect = 3.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -1 Query: 969 GXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGG 835 G GG GG GGG G GG GG GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 29.9 bits (64), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 776 GGXGGGGGXGXXXXXXXXXXXXXXGGGGXXXXXXRGXXGXG 654 GG GGGGG G GGGG G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 32.7 bits (71), Expect = 0.57 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGG 919 GG GGG GG G G G GG GG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 29.5 bits (63), Expect = 5.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 948 GXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGG 835 G RGG GGG G GG GG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGG 118 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 32.3 bits (70), Expect = 0.75 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 1050 RGGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGG 919 RGG GGG GG G G G GG GG GGG Sbjct: 442 RGGDGGG-DGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 32.3 bits (70), Expect = 0.75 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPP 777 P P PR PPPP P PPPPP PP Sbjct: 204 PPPPPPRPPPSPPPPPP------PPSPSPPRPPPPPPPSPP 238 Score = 30.3 bits (65), Expect = 3.0 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +1 Query: 661 PXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPP--PPPXPPAXXXXXXXXXGXXXXXWXX 834 P P PPPP P PP PPP PP+ Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNM 254 Query: 835 PPPXPP 852 PP PP Sbjct: 255 PPTLPP 260 Score = 29.5 bits (63), Expect = 5.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXP 949 PPP PP PP P PPP PP P Sbjct: 204 PPPPPPRPPPSPPPPPPP---PSPSPPRPPPPPPPSPP 238 Score = 29.1 bits (62), Expect = 7.0 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPP 925 PP P PP PP S P P PP PP+ P PP Sbjct: 206 PPPPRPPPSPPPPPPPP---------SPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Query: 926 PXXPP 940 PP Sbjct: 257 TLPPP 261 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.99 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 824 SGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 S PPP P P A P A PPP PP PP P Sbjct: 47 SSSPPPPPPSPPAAAPAAPPPPAAAPAA---PPPPAAPPAAPPPPPPLP 92 Score = 30.3 bits (65), Expect = 3.0 Identities = 15/56 (26%), Positives = 15/56 (26%) Frame = +3 Query: 834 PPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPPXRXXPXPXXXXPXXXXXXXPSP 1001 PPP PP PP PP P P P P P P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 28.7 bits (61), Expect = 9.2 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXPXXXXEXXXLPXGGXP 1015 PPP PP PPA A PPP P PP P LP P Sbjct: 50 PPPPPPSPPA------------AAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 28.7 bits (61), Expect = 9.2 Identities = 17/60 (28%), Positives = 17/60 (28%), Gaps = 2/60 (3%) Frame = +1 Query: 754 PPPPPXPPAXXXXXXXXXGXXXXXWXXP--PPXPPXPXXXXXXXXXXSGXXXXXPPXXPP 927 PPPPP PPA P PP P P PP PP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 28.7 bits (61), Expect = 9.2 Identities = 16/60 (26%), Positives = 17/60 (28%), Gaps = 1/60 (1%) Frame = +1 Query: 835 PPPXPPXP-XXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXPPXXXP 1011 PPP P P + PP PP P P PP PP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.99 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +1 Query: 748 PXPPPPPXPPAXXXXXXXXXGXXXXXWXXPPPXPPXPXXXXXXXXXXSGXXXXXPPXXPP 927 P PPPPP PP PPP PP P S PP PP Sbjct: 102 PPPPPPPPPPP------------------PPPPPPPPITLHHEQHVVSHVMHPAPPPPPP 143 Query: 928 XXPXAXXP 951 P P Sbjct: 144 PPPAPCMP 151 Score = 29.5 bits (63), Expect = 5.3 Identities = 19/72 (26%), Positives = 19/72 (26%), Gaps = 4/72 (5%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXX----PXPPPPPXPPAXXXXXXXXXGXXXX 822 P P P PPPP P PPPPP P Sbjct: 104 PPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQ 163 Query: 823 XWXXPPPXPPXP 858 PP PP P Sbjct: 164 LHASPPGPPPAP 175 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 31.5 bits (68), Expect = 1.3 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG G G GG G G GG RGG GGG G Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDG 196 Query: 867 XAGGXGG 847 G GG Sbjct: 197 RGRGRGG 203 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 1050 RGGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGG 934 RGG GGG GG G GR G G RGG Sbjct: 165 RGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.5 bits (68), Expect = 1.3 Identities = 29/125 (23%), Positives = 33/125 (26%), Gaps = 7/125 (5%) Frame = +1 Query: 661 PXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXXXXXWXXPP 840 P R PPP P PPP PP+ G Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS---NSFTTQGPPLPPSRDQA 307 Query: 841 PXPPXPXXXXXXXXXXSGXXXXXPP------XXPPXXPXAXXPXXXXAXPPXXXXKXP-P 999 P PP P S PP PP P + P + PP + P P Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 367 Query: 1000 XXXPP 1014 PP Sbjct: 368 LGGPP 372 Score = 29.9 bits (64), Expect = 4.0 Identities = 24/102 (23%), Positives = 25/102 (24%) Frame = +2 Query: 695 PPPXXXXXXXXSXXGXXPPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXX 874 PPP P PP +PP G S PPP P Sbjct: 147 PPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP-------H 199 Query: 875 XXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXPXXXXEXXXLP 1000 P PPP P R P P LP Sbjct: 200 SRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLP 241 Score = 29.5 bits (63), Expect = 5.3 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +3 Query: 699 PPXXXXXXXXPXXXXXPPXPXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXGXXX 878 PP P P P PP R PPP P Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPS---RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAP 357 Query: 879 XXXXGAXXXPPXXXPPPPPXRXXP 950 G P PPPPP R P Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPP 381 Score = 29.1 bits (62), Expect = 7.0 Identities = 20/78 (25%), Positives = 21/78 (26%), Gaps = 3/78 (3%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPX---PPAXXXXXXXXRGXPGAXXX 916 PP P PP G PP PP P + G Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 369 Query: 917 XPPPXXPPRXPPXXXXXP 970 PPP P R PP P Sbjct: 370 GPPPPPPGRRPPSGKINP 387 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.5 bits (68), Expect = 1.3 Identities = 29/125 (23%), Positives = 33/125 (26%), Gaps = 7/125 (5%) Frame = +1 Query: 661 PXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXXXXXWXXPP 840 P R PPP P PPP PP+ G Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPS---NSFTTQGPPLPPSRDQA 219 Query: 841 PXPPXPXXXXXXXXXXSGXXXXXPP------XXPPXXPXAXXPXXXXAXPPXXXXKXP-P 999 P PP P S PP PP P + P + PP + P P Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQP 279 Query: 1000 XXXPP 1014 PP Sbjct: 280 LGGPP 284 Score = 29.9 bits (64), Expect = 4.0 Identities = 24/102 (23%), Positives = 25/102 (24%) Frame = +2 Query: 695 PPPXXXXXXXXSXXGXXPPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXX 874 PPP P PP +PP G S PPP P Sbjct: 59 PPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP-------H 111 Query: 875 XXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXPXXXXEXXXLP 1000 P PPP P R P P LP Sbjct: 112 SRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLP 153 Score = 29.5 bits (63), Expect = 5.3 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +3 Query: 699 PPXXXXXXXXPXXXXXPPXPXPPXXARRXXXXXXXXXXXXXXLGXPPPXPPPXXXXGXXX 878 PP P P P PP R PPP P Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPS---RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAP 269 Query: 879 XXXXGAXXXPPXXXPPPPPXRXXP 950 G P PPPPP R P Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPP 293 Score = 29.1 bits (62), Expect = 7.0 Identities = 20/78 (25%), Positives = 21/78 (26%), Gaps = 3/78 (3%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPX---PPAXXXXXXXXRGXPGAXXX 916 PP P PP G PP PP P + G Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 281 Query: 917 XPPPXXPPRXPPXXXXXP 970 PPP P R PP P Sbjct: 282 GPPPPPPGRRPPSGKINP 299 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 31.5 bits (68), Expect = 1.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 694 PPPPXXXXXXXXXXXXXXPXPPPPPXPP 777 PPPP P PPPPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 9.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 836 PPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPP 952 PPP PP PP P + PPP PP PP Sbjct: 1157 PPPPPPPPPP-----------PPSSPSPPPPPPPPPPPP 1184 Score = 28.7 bits (61), Expect = 9.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 694 PPPPXXXXXXXXXXXXXXPXPPPPPXP 774 PPPP P PPPPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 31.5 bits (68), Expect = 1.3 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = -1 Query: 1050 RGGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXX 871 RG GGG G G G + GG GG GGG G Sbjct: 175 RGDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGR 234 Query: 870 XXAGGXGGXGGG 835 GG G GGG Sbjct: 235 HDYGG-GSKGGG 245 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.5 bits (68), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 834 PPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPP 935 PPP PPP G PP PPPP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPP 314 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.5 bits (68), Expect = 1.3 Identities = 18/69 (26%), Positives = 18/69 (26%) Frame = +2 Query: 809 GXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXPXXXXEX 988 G G PPP P P P PPP PP P P Sbjct: 337 GTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Query: 989 XXLPXGGXP 1015 P G P Sbjct: 397 PPPPTNGPP 405 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +1 Query: 661 PXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPPAXXXXXXXXXGXXXXXWXXPP 840 P P PPPP P PPPP P PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 841 PXPP 852 P PP Sbjct: 406 PPPP 409 Score = 31.5 bits (68), Expect = 1.3 Identities = 21/84 (25%), Positives = 22/84 (26%) Frame = +2 Query: 755 PXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXX 934 P PP PP PPP PP G P PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP----PPPPPTN 402 Query: 935 PPRXPPXXXXXPXXXXEXXXLPXG 1006 P PP P + P G Sbjct: 403 GPPPPPPPTNGPPSEGKCGRKPAG 426 Score = 31.1 bits (67), Expect = 1.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 834 PPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPP 935 PPP PPP G PP PPPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 30.3 bits (65), Expect = 3.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 837 PPXPPPXXXXGXXXXXXXGAXXXPPXXX--PPPPPXRXXPXP 956 PP PPP G PP PPPPP P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 29.1 bits (62), Expect = 7.0 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = +1 Query: 838 PPXPPXPXXXXXXXXXXSGXXXXXPPXXPPXXPXAXXPXXXXAXPPXXXXKXPPXXXPP 1014 PP PP P + PP P P P PP PP PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPP--PTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.7 bits (61), Expect = 9.2 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPP 777 P P P PPPP P PPPP P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 30.7 bits (66), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 827 GXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPP 952 G PPP PP PP P PPP PP PP Sbjct: 461 GQAPPPPPPPPPPPP--------PPPPPPPPPPPPFPPPPPP 494 Score = 30.3 bits (65), Expect = 3.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 906 PPXXXPPPPPXRXXPXPXXXXPXXXXXXXPSP 1001 PP PPPPP P P P P+P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 28.7 bits (61), Expect = 9.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 697 PPPXXXXXXXXXXXXXXPXPPPPPXPP 777 PPP P PPPPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP 490 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 30.7 bits (66), Expect = 2.3 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +2 Query: 824 SGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXPPXXXXXP 970 +G PPP PP PP G PG PPP PP P Sbjct: 192 AGMPPPPPPPPPP----------GFPGGAPPPPPPPFGAPPPPALNGGP 230 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 30.7 bits (66), Expect = 2.3 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 834 PPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPPXRXXPXPXXXXP 971 PPP P G PP PPPPP P P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.1 bits (62), Expect = 7.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 842 PXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXP 949 P PP PPA P PPP PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 28.7 bits (61), Expect = 9.2 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 616 PXXXXXGGXXXXXPXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPP 777 P GG P P PPPP P PPPPP PP Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPP---------GGAPPPPPPPPPPPP 325 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.7 bits (66), Expect = 2.3 Identities = 29/102 (28%), Positives = 31/102 (30%) Frame = -1 Query: 1053 ERGGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXX 874 +RGG GGG GG G G GG G GGG G R Sbjct: 728 QRGGRGGGGYGG------GYNDRRMQQGGYGNRSGG---GYRGGGGYGGGGGGYRGGGGY 778 Query: 873 XXXAGGXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXGXG 748 G GG GGG G+ GG G G Sbjct: 779 GGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQG 820 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.3 bits (65), Expect = 3.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 748 PXPPPPPXPPAXXXXXXXXXGXXXXXWXXPPPXPP 852 P PPPPP PA PPP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPP 811 Score = 29.9 bits (64), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 827 GXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPRXP 949 G PPP PP PA P PPP PP P Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPP-PPPGKP 814 Score = 29.1 bits (62), Expect = 7.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 825 LGXPPPXPPPXXXXGXXXXXXXGAXXXPPXXXPPPPP 935 LG PPP PPP + PPPPP Sbjct: 774 LGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPP 810 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 3.0 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 764 PXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPPXXPPR 943 P PP G PPP P P G PG PP PP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 944 XP 949 P Sbjct: 284 PP 285 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 30.3 bits (65), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -1 Query: 1038 GGGXXGGXGXPPXG-RXFXSXXXXGXXXXXGGXRGGXXGGG 919 G G GG G P G R G GG RGG GGG Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.9 bits (64), Expect = 4.0 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 695 PPPXXXXXXXXSXXGXXPPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPP 844 PPP G P P P PP G SG PPP Sbjct: 772 PPPTSTSPSGWQGRGRYPSQPSPTDVLPPTLPQAPYPGGPPSMSGMPPPP 821 >SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 29.9 bits (64), Expect = 4.0 Identities = 32/115 (27%), Positives = 35/115 (30%), Gaps = 12/115 (10%) Frame = -1 Query: 1053 ERGGXG-GGXXGGXGXPPX----GRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPR 889 E+GG G GG GG G P G + S GG G GGG + G Sbjct: 492 EKGGTGSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSGGGGASGGRGGGTIELSIGNSL 551 Query: 888 XXXXXXXXAGG------XGGXGGGXXPXXXXXPXXXXXXXXXG-GRXXGGXGXGG 745 GG GG GG G G GG G GG Sbjct: 552 HLDGQILNTGGNAESNSGGGSGGSILISATLFSGHGVISASGGAGSGTGGGGSGG 606 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 29.9 bits (64), Expect = 4.0 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -1 Query: 1035 GGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGG 856 GG GG G G G GG GG GGG G GG Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDG--GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Query: 855 XGGXGGG 835 G GGG Sbjct: 106 GGDGGGG 112 Score = 29.1 bits (62), Expect = 7.0 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GGG G G G GG G GGG G Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGD-------- 102 Query: 867 XAGGXGGXGGG 835 GG GG GGG Sbjct: 103 --GGGGGDGGG 111 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.9 bits (64), Expect = 4.0 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -1 Query: 1035 GGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGG 856 GG GG G G G GG GG GGG G GG Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDG--GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Query: 855 XGGXGGG 835 G GGG Sbjct: 121 GGDGGGG 127 Score = 29.1 bits (62), Expect = 7.0 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -1 Query: 1047 GGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGGXXXXAPGXPRXXXXXXX 868 GG GGG G G G GG G GGG G Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGD-------- 117 Query: 867 XAGGXGGXGGG 835 GG GG GGG Sbjct: 118 --GGGGGDGGG 126 >SB_45874| Best HMM Match : TIR (HMM E-Value=0.43) Length = 876 Score = 22.6 bits (46), Expect(3) = 5.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 828 GXPPPXPPP 854 G PPP PPP Sbjct: 304 GPPPPPPPP 312 Score = 21.8 bits (44), Expect(3) = 5.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 921 PPPPPXRXXPXP 956 PPPPP P P Sbjct: 308 PPPPPTSIGPKP 319 Score = 21.4 bits (43), Expect(3) = 5.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 834 PPPXPPPXXXXG 869 PPP PPP G Sbjct: 305 PPPPPPPPTSIG 316 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.5 bits (63), Expect = 5.3 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 655 PXPXXPRXXXXXXPPPPXXXXXXXXXXXXXXPXPPPPPXPP 777 P P PPPP P PPPP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 29.5 bits (63), Expect = 5.3 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 939 GGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGG 835 GG G G G PR GG GG GGG Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGG 221 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.1 bits (62), Expect = 7.0 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 755 PXPPXXR-PPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPP 928 P PP PP G G PP PP PP +G PG PP Sbjct: 604 PGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPG----PPGPKGPPGPNGPLGPP 658 Score = 29.1 bits (62), Expect = 7.0 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 755 PXPPXXR-PPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPP 928 P PP PP G G PP PP PP +G PG PP Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPG----PPGPKGPPGPNGPLGPP 828 Score = 29.1 bits (62), Expect = 7.0 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 755 PXPPXXR-PPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPPP 928 P PP PP G G PP PP PP +G PG PP Sbjct: 859 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPG----PPGPKGPPGPNGCLGPP 913 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.1 bits (62), Expect = 7.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 951 GGXRGGXXGGGXXXXAPGXPRXXXXXXXXAGGXGGXGGG 835 GG GG GGG G A G GG GGG Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 29.1 bits (62), Expect = 7.0 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +2 Query: 746 PPXPXPPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXPPAXXXXXXXXRGXPGAXXXXPP 925 PP P P PP S PPP P P A P PP Sbjct: 857 PPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPP--PRPAADESQEMSRTRGP-KDGRKPP 913 Query: 926 PXXPPR 943 P PPR Sbjct: 914 PPPPPR 919 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.1 bits (62), Expect = 7.0 Identities = 23/89 (25%), Positives = 24/89 (26%), Gaps = 3/89 (3%) Frame = +2 Query: 695 PPPXXXXXXXXSXXGXXPPXPXPPXXRPPXXXXXXXXXGXXXXS-GXXPPPXPPXPPAXX 871 PPP P PP P G G PPP PP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFG 488 Query: 872 XXXXXXRGXPGAXXXXPPP--XXPPRXPP 952 RG P PPP P + PP Sbjct: 489 PPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.1 bits (62), Expect = 7.0 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 2/65 (3%) Frame = +2 Query: 761 PPXXRPPXXXXXXXXXGXXXXSGXXPPPXPPXP--PAXXXXXXXXRGXPGAXXXXPPPXX 934 PP PP G G P PP P P G P P P Sbjct: 382 PPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGM 441 Query: 935 PPRXP 949 PP P Sbjct: 442 PPMRP 446 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 9.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 1053 ERGGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGG 919 ERGG GG GG G S G GG GG GGG Sbjct: 181 ERGG-GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG 224 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 28.7 bits (61), Expect = 9.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 1053 ERGGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRGGXXGGG 919 ERGG GG GG G S G GG GG GGG Sbjct: 90 ERGG-GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG 133 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 28.7 bits (61), Expect = 9.2 Identities = 29/105 (27%), Positives = 29/105 (27%), Gaps = 3/105 (2%) Frame = -1 Query: 1050 RGGXGGGXXGGXGXPPXGRXFXSXXXXGXXXXXGGXRG-GXXGGGXXXXAPGXPRXXXXX 874 RGG GG GG G G G GG G G GG G Sbjct: 35 RGGIAGGRMGGGGM--AGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEG 92 Query: 873 XXXAG--GXGGXGGGXXPXXXXXPXXXXXXXXXGGRXXGGXGXGG 745 G G G GGG GG G G GG Sbjct: 93 MGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEGMGRGG 137 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,803,242 Number of Sequences: 59808 Number of extensions: 333116 Number of successful extensions: 4437 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2163 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3533503114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -