BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C18 (945 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 169 2e-42 SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 90 2e-18 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 89 4e-18 SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 2e-15 SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) 73 4e-13 SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 71 1e-12 SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 9e-11 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 65 9e-11 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_48533| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47211| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_46066| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_45109| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_43715| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_42865| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_41269| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_40020| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_38531| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_35148| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_31008| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_29391| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_24808| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_23019| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_21707| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_19542| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_19098| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_19031| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_17805| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_15695| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_12040| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_9760| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_5267| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_1707| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_1382| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_1275| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_6381| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_30985| Best HMM Match : DUF1450 (HMM E-Value=1.5) 62 5e-10 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_51245| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 60 3e-09 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_25122| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 6e-08 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_25376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 45 1e-04 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 45 1e-04 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 45 1e-04 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 45 1e-04 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 45 1e-04 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 45 1e-04 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 45 1e-04 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 45 1e-04 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 1e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 45 1e-04 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 45 1e-04 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 45 1e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 45 1e-04 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 45 1e-04 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 45 1e-04 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 45 1e-04 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 45 1e-04 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 45 1e-04 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 45 1e-04 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 45 1e-04 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 45 1e-04 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 45 1e-04 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 45 1e-04 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 45 1e-04 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 45 1e-04 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 45 1e-04 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 45 1e-04 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 45 1e-04 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 45 1e-04 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 45 1e-04 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 45 1e-04 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 45 1e-04 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 45 1e-04 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 1e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 45 1e-04 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 45 1e-04 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 45 1e-04 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 45 1e-04 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 45 1e-04 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 45 1e-04 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 45 1e-04 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 45 1e-04 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 45 1e-04 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 45 1e-04 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 45 1e-04 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 45 1e-04 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 45 1e-04 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 45 1e-04 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 45 1e-04 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 45 1e-04 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 1e-04 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 45 1e-04 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 169 bits (412), Expect = 2e-42 Identities = 86/134 (64%), Positives = 94/134 (70%) Frame = +3 Query: 210 KEHVSKRPAKGQEP*KGRVCWRFSIGSAPLXEHHKNRRSSQRWRNPTGL*RYQAFPPGSS 389 ++ SKRP + P CWRFSIGSAPL K + + FP + Sbjct: 96 EQKASKRPGTVKRP----RCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAP 151 Query: 390 LXALSCFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSPTAAP 569 AL FRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSPTAAP Sbjct: 152 SCAL-LFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNPPFSPTAAP 210 Query: 570 YPVTIVLSPTRXRH 611 YPVTIVLSPTR ++ Sbjct: 211 YPVTIVLSPTRTKN 224 Score = 54.8 bits (126), Expect = 1e-07 Identities = 33/70 (47%), Positives = 38/70 (54%) Frame = +2 Query: 200 ITQERTCEQKASKRPGTVKRPRLLAFFHRLRPPXRASQKSTLKSEVAKPDRTIKIPGVSP 379 ITQERTCEQKASKRPGTVKRPR F P + K + + + K P Sbjct: 89 ITQERTCEQKASKRPGTVKRPRCWRFSIG-SAPLTSITKIDAQVRGGETRQDYKDTRRFP 147 Query: 380 WKLPRCALLF 409 + P CALLF Sbjct: 148 LEAPSCALLF 157 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 90.2 bits (214), Expect = 2e-18 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 49 ESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 171 ESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 103 ESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 90.2 bits (214), Expect = 2e-18 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 49 ESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 171 ESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 467 ESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 89.4 bits (212), Expect = 4e-18 Identities = 52/112 (46%), Positives = 61/112 (54%) Frame = +3 Query: 210 KEHVSKRPAKGQEP*KGRVCWRFSIGSAPLXEHHKNRRSSQRWRNPTGL*RYQAFPPGSS 389 ++ SKRP + P CWRFSIGSAPL K + + FP + Sbjct: 125 EQKASKRPGTVKRP----RCWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAP 180 Query: 390 LXALSCFRPCRLPDTCPPFSLREAWRFLIAHAVGISVRCRSFAPSWAVCTNP 545 AL FRPCRLPDTCPPFSLREAWRFLIAHAV I ++F S + P Sbjct: 181 SCAL-LFRPCRLPDTCPPFSLREAWRFLIAHAVAIRTAKKTFQGSTSSMAAP 231 Score = 54.8 bits (126), Expect = 1e-07 Identities = 33/70 (47%), Positives = 38/70 (54%) Frame = +2 Query: 200 ITQERTCEQKASKRPGTVKRPRLLAFFHRLRPPXRASQKSTLKSEVAKPDRTIKIPGVSP 379 ITQERTCEQKASKRPGTVKRPR F P + K + + + K P Sbjct: 118 ITQERTCEQKASKRPGTVKRPRCWRFSIG-SAPLTSITKIDAQVRGGETRQDYKDTRRFP 176 Query: 380 WKLPRCALLF 409 + P CALLF Sbjct: 177 LEAPSCALLF 186 >SB_27738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 86.6 bits (205), Expect = 3e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPXKTRLIATGSS 634 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP + RLIATGSS Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVRHRLIATGSS 42 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 80.2 bits (189), Expect = 2e-15 Identities = 50/106 (47%), Positives = 59/106 (55%) Frame = +1 Query: 76 VCVLGALPLPRSLTRCARSFGCGERYQLTQRR*YGYPQNQGDNAGKNM*AKGQQKARNRK 255 +C G +PLPRSLTR ARSF CGER LT + G+ + G ++A + Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLTNGAEISWKM-----PGRYL--TGSERAAAKP 112 Query: 256 KXXXXXXXXXXXXXXTSITKIDAQVRGGETRQDYKDTRRFPLEAPS 393 TSITK DAQ+ GGETRQDYKDTRRFPL APS Sbjct: 113 -------FFHRLRPLTSITKSDAQISGGETRQDYKDTRRFPLAAPS 151 Score = 35.9 bits (79), Expect = 0.048 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 47 LNRPTRGERRFAYW 88 +NRPTRGERRFAYW Sbjct: 11 MNRPTRGERRFAYW 24 >SB_35724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 74.9 bits (176), Expect = 8e-14 Identities = 37/48 (77%), Positives = 37/48 (77%) Frame = +1 Query: 673 GATEFLKWWPNYGYTRRTVFGICALLKPVTSEKXGKXXXGXLLXPANK 816 GATEFLKWWPNYGYTRRTVFGICALLKPVT GK L PANK Sbjct: 55 GATEFLKWWPNYGYTRRTVFGICALLKPVT---FGKELVA--LDPANK 97 Score = 72.9 bits (171), Expect = 3e-13 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP + Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVR 33 Score = 55.2 bits (127), Expect = 7e-08 Identities = 28/50 (56%), Positives = 29/50 (58%) Frame = +3 Query: 543 PPFSPTAAPYPVTIVLSPTRXRHDLSPLAAATGNRISRARYVGGCYRVLE 692 PP P L RHDLSPLAAATGNRISRARYVGG L+ Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLK 61 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 72.9 bits (171), Expect = 3e-13 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP + Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVR 33 Score = 55.2 bits (127), Expect = 7e-08 Identities = 28/50 (56%), Positives = 29/50 (58%) Frame = +3 Query: 543 PPFSPTAAPYPVTIVLSPTRXRHDLSPLAAATGNRISRARYVGGCYRVLE 692 PP P L RHDLSPLAAATGNRISRARYVGG L+ Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAATGNRISRARYVGGATEFLK 61 Score = 44.4 bits (100), Expect = 1e-04 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +1 Query: 673 GATEFLKWWPNYGYTR 720 GATEFLKWWPNYGYTR Sbjct: 55 GATEFLKWWPNYGYTR 70 >SB_7309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 72.9 bits (171), Expect = 3e-13 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP + Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVR 33 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 543 PPFSPTAAPYPVTIVLSPTRXRHDLSPLAAAT 638 PP P L RHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_1903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 72.9 bits (171), Expect = 3e-13 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP + Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPVR 33 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 543 PPFSPTAAPYPVTIVLSPTRXRHDLSPLAAAT 638 PP P L RHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESNPVRHDLSPLAAAT 43 >SB_58224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_55737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_54286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_54219| Best HMM Match : Toxin_8 (HMM E-Value=8.1) Length = 75 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 45 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 75 >SB_41217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_38325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_17471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_16089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_9623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_59708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_59685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_59589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_59479| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_58142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_57899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_57889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_57793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_57693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_57320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_55905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_55790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_55716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_55631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_55333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_55090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_54702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_54683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_54384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_53884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 34 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 64 >SB_53624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_53241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_52402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_51349| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_51271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_50626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_49587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_49375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_49357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_49260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_49181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_48829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_48601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_48323| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_48037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_47484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_47382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_47359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_47312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_46998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_46785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_46606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_46553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_46274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_46222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_46158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_45670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_45556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_45238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_44797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_44462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_43465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_42828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_42781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_42533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_42195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_41845| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_40938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_39214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_38586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_38311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_37725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_37267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_37229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_36145| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_35184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_34961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_34855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_34644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_34569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_33632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_33419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_33059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_32948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_32667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_32556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_31680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_31259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_30530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_30465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_30185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_29900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_29015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_28377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_28369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_28136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_27976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_27792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_27734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_26258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_26165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_25748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_25006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_24933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_24744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_24530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_23602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_23082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_23076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_22933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_22408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_22371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_21708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_21671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_21133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_21107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_20737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_20572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_19574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_19433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_18666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_17812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_17809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_17259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_17176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_16930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_16732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_16453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_15769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_15576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_15019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_14967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_14861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_14376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_14280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_14068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_12970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_12483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_12400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_11534| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_11286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_11221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_10946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_10173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_9717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_9609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_9186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_9181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_8098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_7942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_7762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_7701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_5634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_5583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_5352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_4816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_4803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_4739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_4616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_4498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_4379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_3983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_3821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_3004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_2988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_2927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_2917| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_2901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_2472| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_2187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_2000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_1265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_33| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 72.5 bits (170), Expect = 4e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 31 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 70.9 bits (166), Expect = 1e-12 Identities = 60/153 (39%), Positives = 75/153 (49%), Gaps = 1/153 (0%) Frame = +1 Query: 76 VCVLGALPLPRSLTRCARSFGCGERYQLTQRR*YGYPQNQGDNAGKNM*AKGQQKARNRK 255 +C G +PLPRSLTR ARSF CGER LT N G + + +K NR+ Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT-------------NGGGDF-LEDARKILNRE 142 Query: 256 -KXXXXXXXXXXXXXXTSITKIDAQVRGGETRQDYKDTRRFPLEAPSXRSPVSDPAAYRI 432 + TSITK DAQ+ GGETRQDYKDTRR +A + + P + Sbjct: 143 VRGPRQSRFSIGSAPLTSITKSDAQISGGETRQDYKDTRRLH-QAGTLCGVLILP--FGF 199 Query: 433 PVRLSPFGKRGAFS*LTL*VSQFGVGRSLQAGL 531 PV +G+ S + V QF V SL GL Sbjct: 200 PVSFRCYGR---VSLMPTPVDQFRVDISLLEGL 229 Score = 35.9 bits (79), Expect = 0.048 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 47 LNRPTRGERRFAYW 88 +NRPTRGERRFAYW Sbjct: 48 MNRPTRGERRFAYW 61 >SB_34414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 70.5 bits (165), Expect = 2e-12 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VVRSKLGCVHEPPVQPDRCALSGNYRLES P + Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLESKPVR 33 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 543 PPFSPTAAPYPVTIVLSPTRXRHDLSPLAAAT 638 PP P L RHDLSPLAAAT Sbjct: 12 PPVQPDRCALSGNYRLESKPVRHDLSPLAAAT 43 >SB_49591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 68.1 bits (159), Expect = 1e-11 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +2 Query: 509 VVRSKLGCVHEPPVQPDRCALSGNYRLESNP 601 VVRSKLGCVHEPPVQPDRCALSGNYRLE +P Sbjct: 1 VVRSKLGCVHEPPVQPDRCALSGNYRLEVHP 31 >SB_38053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 67.7 bits (158), Expect = 1e-11 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +2 Query: 518 SKLGCVHEPPVQPDRCALSGNYRLESNPXKTRLIATGSS 634 S LGCVHEPPVQPDRCALSGNYRLESNP + L G++ Sbjct: 56 SNLGCVHEPPVQPDRCALSGNYRLESNPGRPDLSPLGTA 94 Score = 33.5 bits (73), Expect = 0.25 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +3 Query: 492 ISVRCRSFAPSWAVCTN-PPFSPTAAPYPVTIVLSPTRXRHDLSPLAAATGNRI 650 + V+C+ S C + PP P L R DLSPL ATGNRI Sbjct: 46 VIVKCKCSMMSNLGCVHEPPVQPDRCALSGNYRLESNPGRPDLSPLGTATGNRI 99 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 66.1 bits (154), Expect = 4e-11 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 302 VQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 V GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -3 Query: 475 MRKRHASRREKGGQVSGKRQGRKQES 398 MRKRHASRREKGGQVSG R K S Sbjct: 1 MRKRHASRREKGGQVSGGRSLWKNAS 26 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 64.9 bits (151), Expect = 9e-11 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -2 Query: 305 LVQGGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 L GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 56 LNSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 92 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 80 WPFAHMF----FPALSPDSVDNRITAF 102 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 309 DARXGGRSLWKNASKRGLFTVPGLLLAFC 223 D GGRSLWKNAS LAFC Sbjct: 55 DLNSGGRSLWKNASNAAFLR----FLAFC 79 >SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) Length = 108 Score = 64.9 bits (151), Expect = 9e-11 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +2 Query: 491 YLSSV*VVRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 + V VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 59 FFRGVKAVRSKLDCMHEPPVQSDRCALSGNYRLESNPER 97 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 64.5 bits (150), Expect = 1e-10 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -2 Query: 296 GGGAYGKTPANAAFLRFLAFCWPFAHMFFPALSP 195 GG + K +NAAFLRFLAFCWPFAHMFFPALSP Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 126 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -3 Query: 244 WPFAGLLLTCSFLRYHPDSVDNRITAF 164 WPFA + F PDSVDNRITAF Sbjct: 114 WPFAHMF----FPALSPDSVDNRITAF 136 >SB_54507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 15 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 46 >SB_58426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 33 >SB_57366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 33 >SB_56245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 33 >SB_55566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 33 >SB_55077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 33 >SB_53790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 33 >SB_52894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 64.1 bits (149), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +2 Query: 512 VRSKLGCVHEPPVQPDRCALSGNYRLESNPXK 607 VRSKL C+HEPPVQ DRCALSGNYRLESNP + Sbjct: 2 VRSKLDCMHEPPVQSDRCALSGNYRLESNPER 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,193,215 Number of Sequences: 59808 Number of extensions: 587337 Number of successful extensions: 3455 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3374 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2764790632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -