BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C18 (945 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 31 0.067 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 31 0.067 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 27 1.1 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 30.7 bits (66), Expect = 0.067 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +2 Query: 287 LRP--PXRASQKSTLKSEVAKPDRTIKIPGVSPWKLPRCALLFPTLPLTGYLSAFLPSGS 460 LRP P A Q+ EV + +PGV+ W P+ FPT + A + SG+ Sbjct: 48 LRPLIPDEAPQQPEKWEEVMADVERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGA 107 Query: 461 VA 466 +A Sbjct: 108 IA 109 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 30.7 bits (66), Expect = 0.067 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = +2 Query: 287 LRP--PXRASQKSTLKSEVAKPDRTIKIPGVSPWKLPRCALLFPTLPLTGYLSAFLPSGS 460 LRP P A Q+ EV + +PGV+ W P+ FPT + A + SG+ Sbjct: 79 LRPLIPDEAPQQPEKWEEVMADVERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGA 138 Query: 461 VA 466 +A Sbjct: 139 IA 140 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 26.6 bits (56), Expect = 1.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 Query: 222 SHVLSCVITLILWITVLPPLSELIPLAA 139 S +LS V+ L+L +LPP S ++PL A Sbjct: 269 SILLSLVVFLLLVSKILPPTSLVLPLIA 296 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 885,058 Number of Sequences: 2352 Number of extensions: 17775 Number of successful extensions: 39 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 103362750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -