BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C17 (865 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48615-1|CAA88531.1| 953|Homo sapiens serine/threonine kinase w... 33 1.3 X90846-1|CAA62351.1| 954|Homo sapiens mixed lineage kinase 2 pr... 33 1.3 AK092711-1|BAC03955.1| 149|Homo sapiens protein ( Homo sapiens ... 31 5.4 >Z48615-1|CAA88531.1| 953|Homo sapiens serine/threonine kinase with SH3 domain, leucine zipper domain and proline rich protein. Length = 953 Score = 33.1 bits (72), Expect = 1.3 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -2 Query: 648 GSEQESARGSFQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRPFYGSWP 475 GS+Q S+ G++P + GFA+ + +F +A GG + +P + P Y S P Sbjct: 581 GSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVP 638 >X90846-1|CAA62351.1| 954|Homo sapiens mixed lineage kinase 2 protein. Length = 954 Score = 33.1 bits (72), Expect = 1.3 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -2 Query: 648 GSEQESARGSFQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRPFYGSWP 475 GS+Q S+ G++P + GFA+ + +F +A GG + +P + P Y S P Sbjct: 582 GSKQWSSSAPNLGKSPKHTPIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVP 639 >AK092711-1|BAC03955.1| 149|Homo sapiens protein ( Homo sapiens cDNA FLJ35392 fis, clone SKNSH2000716. ). Length = 149 Score = 31.1 bits (67), Expect = 5.4 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 537 RQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPPDSV 421 RQ G G A R F S P GLL CS LR PDSV Sbjct: 69 RQHFGIPGYPEAARDFSSS-PAPGLLTLCSRLRAKPDSV 106 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,159,717 Number of Sequences: 237096 Number of extensions: 2386281 Number of successful extensions: 6987 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6985 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 11039988564 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -