BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C11 (937 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 25 0.99 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 25 0.99 DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse tr... 24 2.3 DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse tr... 24 2.3 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 23 3.0 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 23 3.0 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 23 3.0 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 23 3.0 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 3.0 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 3.0 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 23 3.0 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 23 4.0 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 23 4.0 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.0 bits (52), Expect = 0.99 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 Query: 164 YYLYGA*YYFSFSYIRN 214 YY YGA + F+F++I+N Sbjct: 297 YYDYGADFPFNFAFIKN 313 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 25.0 bits (52), Expect = 0.99 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 Query: 164 YYLYGA*YYFSFSYIRN 214 YY YGA + F+F++I+N Sbjct: 297 YYDYGADFPFNFAFIKN 313 >DQ494419-1|ABF55370.1| 127|Apis mellifera telomerase reverse transcriptase protein. Length = 127 Score = 23.8 bits (49), Expect = 2.3 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 206 YKKMKNNIKPHTGNTRKKYTIRFQVTSKVRCFKFKKIILHL 84 +K +K+ + T + + I Q TSK++ +K+ ILH+ Sbjct: 63 FKIIKSTNEKITRYIIRMFLISQQKTSKLKIYKWNNQILHI 103 >DQ494418-1|ABF55369.1| 110|Apis mellifera telomerase reverse transcriptase protein. Length = 110 Score = 23.8 bits (49), Expect = 2.3 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 206 YKKMKNNIKPHTGNTRKKYTIRFQVTSKVRCFKFKKIILHL 84 +K +K+ + T + + I Q TSK++ +K+ ILH+ Sbjct: 46 FKIIKSTNEKITRYIIRMFLISQQKTSKLKIYKWNNQILHI 86 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 75 KSKEPKIISSLSNNYNYNNYNNNYKP 100 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 75 KSKEPKIISSLSNNYNYNNYNNNYKP 100 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 75 KSKEPKIISSLSNNYNYNNYNNNYKP 100 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 75 KSKEPKIISSLSNNYNYNNYNNNYKP 100 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 308 KSKEPKIISSLSNNYNYNNYNNNYKP 333 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 308 KSKEPKIISSLSNNYNYNNYNNNYKP 333 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 308 KSKEPKIISSLSNNYNYNNYNNNYKP 333 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 308 KSKEPKIISSLSNNYNYNNYNNNYKP 333 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 308 KSKEPKIISSLSNNYNYNNYNNNYKP 333 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 3.0 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 Query: 254 KSSGLRICQRICFNYEYKKMKNNIKP 177 KS +I + NY Y NN KP Sbjct: 297 KSKEPKIISSLSNNYNYNNYNNNYKP 322 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 23.0 bits (47), Expect = 4.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 425 DSPNEDGFDSDVFNPGLVLGL 363 D E+G S+ +PGLV G+ Sbjct: 116 DGDEENGLTSESTDPGLVAGI 136 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 23.0 bits (47), Expect = 4.0 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 425 DSPNEDGFDSDVFNPGLVLGL 363 D E+G S+ +PGLV G+ Sbjct: 87 DGDEENGLTSESTDPGLVAGI 107 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,053 Number of Sequences: 438 Number of extensions: 4031 Number of successful extensions: 22 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30597567 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -