BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C10 (899 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34622| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 7e-24 SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 92 5e-19 SB_8916| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) 58 7e-09 SB_33699| Best HMM Match : Aldo_ket_red (HMM E-Value=3.1) 52 5e-07 SB_56309| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_56768| Best HMM Match : VWA (HMM E-Value=0.0042) 29 3.9 SB_52108| Best HMM Match : DUF1053 (HMM E-Value=6) 29 3.9 SB_16774| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 4.7 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 29 5.1 SB_34637| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_6739| Best HMM Match : RCC1 (HMM E-Value=1.6e-34) 28 8.9 SB_17878| Best HMM Match : Drf_FH1 (HMM E-Value=0.022) 25 9.7 >SB_34622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 340 Score = 108 bits (259), Expect = 7e-24 Identities = 56/124 (45%), Positives = 75/124 (60%) Frame = +2 Query: 353 VATLKLRDGTFMPVIALGTALLPPRLTTEIVETAIDMGYRAIDTAYIYGNEKLIGKAIKN 532 +AT+KL +G MPV+ LGT P V+ AI GYR ID AY Y NEK +G A++ Sbjct: 1 MATVKLNNGLEMPVLGLGTWKSKPGQVENAVKFAIKEGYRHIDCAYAYRNEKEVGDALRE 60 Query: 533 KIDDGTVRRDELFIMGKLWSTFHRTDLVETACRISLADLGLEFFDLFLIHNPMSLKEGNS 712 + V R +LFI KLW+T H V + C SL DLGL++ DL+LIH P+S ++G+ Sbjct: 61 LLGS-VVERKDLFITSKLWNTKHNPKDVRSNCVDSLKDLGLDYLDLYLIHWPLSFRDGDE 119 Query: 713 SIPK 724 PK Sbjct: 120 FFPK 123 >SB_7528| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 407 Score = 92.3 bits (219), Expect = 5e-19 Identities = 42/88 (47%), Positives = 60/88 (68%) Frame = +2 Query: 443 VETAIDMGYRAIDTAYIYGNEKLIGKAIKNKIDDGTVRRDELFIMGKLWSTFHRTDLVET 622 V AI++GYR ID A IYGNE IG+A+ + +G V+R+ELF+ KLW H D V Sbjct: 71 VRLAIELGYRHIDCAEIYGNEGEIGEALSEVLTEGKVKREELFVTSKLWCDSHHPDDVLP 130 Query: 623 ACRISLADLGLEFFDLFLIHNPMSLKEG 706 AC+ +L +L L++ DL+LIH P++ K+G Sbjct: 131 ACQATLKNLQLDYLDLYLIHIPVAFKKG 158 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/75 (34%), Positives = 40/75 (53%) Frame = +2 Query: 443 VETAIDMGYRAIDTAYIYGNEKLIGKAIKNKIDDGTVRRDELFIMGKLWSTFHRTDLVET 622 V A ++GYR ID A I+GNE G+A+ + G V+R+E G W + + V Sbjct: 18 VRLAAELGYRLIDCAEIHGNE---GEALSGVLTKGKVKREE---CGSTWQS--SKEEVGN 69 Query: 623 ACRISLADLGLEFFD 667 A R+++ +LG D Sbjct: 70 AVRLAI-ELGYRHID 83 >SB_8916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 61.7 bits (143), Expect = 8e-10 Identities = 43/111 (38%), Positives = 61/111 (54%), Gaps = 1/111 (0%) Frame = +2 Query: 356 ATLKLRDGTFMPVIALGTALLPPRLTTEIVETAIDMGYRAIDTAYIYG-NEKLIGKAIKN 532 A + L G MPV+ GTA L T +V+TA++ GYR IDTA Y +E + KAI Sbjct: 327 ADVLLASGYTMPVMGFGTATLGED-TLSVVKTALETGYRLIDTAQGYPLSEPQVAKAIA- 384 Query: 533 KIDDGTVRRDELFIMGKLWSTFHRTDLVETACRISLADLGLEFFDLFLIHN 685 D G R+D +FI+ KL + + + +SL L ++ DLFLIH+ Sbjct: 385 --DSGIPRKD-IFIITKLHPRYLGYEPTLKSVEMSLRALSTDYIDLFLIHS 432 >SB_54717| Best HMM Match : Aldo_ket_red (HMM E-Value=0) Length = 333 Score = 58.4 bits (135), Expect = 7e-09 Identities = 37/112 (33%), Positives = 62/112 (55%) Frame = +2 Query: 356 ATLKLRDGTFMPVIALGTALLPPRLTTEIVETAIDMGYRAIDTAYIYGNEKLIGKAIKNK 535 +T + DG +P++ LG + + + V A++ GYR IDTA Y NE+ +G+A++ Sbjct: 66 STRIMNDGRKIPLLGLGAHDIHSK---QAVLWALESGYRLIDTASRYHNEQSVGEAVR-- 120 Query: 536 IDDGTVRRDELFIMGKLWSTFHRTDLVETACRISLADLGLEFFDLFLIHNPM 691 + R E++++ K++ T H A SL LGL + DL+LIH P+ Sbjct: 121 --CSNIPRCEIYVVTKVYFTEHGYKETMDAFYKSLTRLGLGYVDLYLIHFPV 170 >SB_33699| Best HMM Match : Aldo_ket_red (HMM E-Value=3.1) Length = 93 Score = 52.4 bits (120), Expect = 5e-07 Identities = 33/94 (35%), Positives = 51/94 (54%) Frame = +2 Query: 368 LRDGTFMPVIALGTALLPPRLTTEIVETAIDMGYRAIDTAYIYGNEKLIGKAIKNKIDDG 547 L DG +P LG L + T + V A++ GYR IDTA Y NEK +G+A++ + Sbjct: 3 LSDGYKIPRFGLGLYDLDEKHTKQAVLWALENGYRMIDTAASYNNEKRVGEALR----ES 58 Query: 548 TVRRDELFIMGKLWSTFHRTDLVETACRISLADL 649 V R E++++ K++ T H + A SL+ L Sbjct: 59 AVPRSEVYLVTKVYHTDHGYEKTMKAYDRSLSAL 92 >SB_56309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/79 (32%), Positives = 43/79 (54%) Frame = +2 Query: 452 AIDMGYRAIDTAYIYGNEKLIGKAIKNKIDDGTVRRDELFIMGKLWSTFHRTDLVETACR 631 A+ GYR +DTA IY NEK +G A++ ++R+++++ KL + + Sbjct: 53 ALKNGYRMLDTADIYQNEKEVGSAVRK----SGLKREDIYVTTKLKPSEEGHSNALKYAK 108 Query: 632 ISLADLGLEFFDLFLIHNP 688 S+ L + + DLFLIH P Sbjct: 109 ESIKKLDIGYVDLFLIHTP 127 >SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 983 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 710 CCLPSTTSDCG*GRGRKTPSPGLPVKSCRP 621 C P ++CG GRG + S LP +SC P Sbjct: 283 CIFPENDTECGGGRGFEEGSRLLPYESCHP 312 >SB_56768| Best HMM Match : VWA (HMM E-Value=0.0042) Length = 815 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +2 Query: 230 SGQRRLDNGKQKRDTGDLTDEQYKTRIAELNEAKLKGSVKEVATLK 367 S R+D K RD L E++ RIA LN K KG ++ A +K Sbjct: 90 SSASRIDGKKVIRDLAGLLRERFDERIAALNAIK-KGVEEDYAAVK 134 >SB_52108| Best HMM Match : DUF1053 (HMM E-Value=6) Length = 349 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 574 NEKLVSPHGAVVNLVLDRFSYELFVAVNISGIYSSVAHI 458 N++LV+ H VLD+F+ E FVA + + SVA + Sbjct: 66 NQELVTAHDDAQENVLDQFADEAFVASAFAAMGESVASV 104 >SB_16774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 25.4 bits (53), Expect(2) = 4.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 629 CRPSPPDRCDGMYSTIYP 576 C PS P +CDG + +P Sbjct: 225 CHPSTPTKCDGPVQSKFP 242 Score = 22.2 bits (45), Expect(2) = 4.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 713 NCCLPSTTSDC 681 NCC PST + C Sbjct: 223 NCCHPSTPTKC 233 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 Query: 385 HAGHSLGHSFASSTVNNGNSG 447 H GHS GHSF S V G+SG Sbjct: 979 HPGHSFGHSFGKSKV-EGSSG 998 >SB_34637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -3 Query: 774 PGVPCSRTXEYWITDDIFGIELLPSFNDIGLWMRKRSKNSKPRSASEILQAVST 613 P P + W++ D F + P+F + R R K+SK + Q ST Sbjct: 71 PVSPEEEENDKWLSADFFAGGVEPAFVEQTFKKRSRDKDSKDEKIEQFTQPTST 124 >SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1642 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 3/37 (8%) Frame = +2 Query: 227 GSGQRRLDNGKQKRDTGDLT---DEQYKTRIAELNEA 328 G G+ +D+G+ D+G+LT D ++K+ EL+E+ Sbjct: 1367 GGGELTIDSGELTIDSGELTIGGDPEFKSEYRELSES 1403 >SB_6739| Best HMM Match : RCC1 (HMM E-Value=1.6e-34) Length = 1790 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = -3 Query: 774 PGVPCSRTXEYWITDDIFGIELLPSFNDIGLWMRKRSKNSKPRSASEILQAVST 613 P P + W++ D F + P+F + R R K+SK + Q ST Sbjct: 1342 PVSPEEEENDKWLSADFFAGGVEPAFVEQTFKKRSRDKDSKDEKIEQFTQPTST 1395 >SB_17878| Best HMM Match : Drf_FH1 (HMM E-Value=0.022) Length = 664 Score = 25.4 bits (53), Expect(2) = 9.7 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 701 PSTTSDCG*GRGRKTPSPGLPVKSCRPSPPDRC 603 P+ S G G TPSP L C PS C Sbjct: 212 PAERSLKGAKGGDGTPSPSLSTAPCEPSTSSSC 244 Score = 21.0 bits (42), Expect(2) = 9.7 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 707 CLPSTTSDCG 678 C PST+S CG Sbjct: 172 CEPSTSSSCG 181 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,368,420 Number of Sequences: 59808 Number of extensions: 534753 Number of successful extensions: 3838 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3830 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2586032617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -