BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C03 (892 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 27 1.0 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 26 1.8 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 25 3.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 5.4 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 24 7.1 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 26.6 bits (56), Expect = 1.0 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -2 Query: 798 PHQSSREEIPQGPSRTVSRTSCDLSCNQGICRTLPSRNSGGEM 670 P + + + GP RT T D C + +CR L + + E+ Sbjct: 1028 PQRKATKRSDSGPDRTEPDTLLDEQCLEELCRLLDAGSGWREL 1070 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 25.8 bits (54), Expect = 1.8 Identities = 13/35 (37%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 576 PGLNPARSYAPIGRATWS-PRLAPARSPPWGTTSP 677 P + P + GR WS P + P R PPW P Sbjct: 68 PAIQPVGIFGRPGRPWWSVPGIPPFR-PPWHPRPP 101 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 25.0 bits (52), Expect = 3.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 589 GFNPGNVCRVCPGQPTVIVFGQSF 518 GF+P VC++ PG I Q F Sbjct: 374 GFHPSTVCKIPPGCSLKIFNNQEF 397 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +3 Query: 663 GTTSPPRNYEKAVSDRFPGCMRGR 734 G +SPP+ E + D FP G+ Sbjct: 1585 GASSPPKVIELTIGDPFPAIAAGQ 1608 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 23.8 bits (49), Expect = 7.1 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -1 Query: 400 NLWSESGQLWRRLRRPSHSSLVGGAA 323 +LW+ +W+R+ R +L+G A Sbjct: 219 DLWTRCEAMWKRIDRSECRNLIGDMA 244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 853,783 Number of Sequences: 2352 Number of extensions: 16822 Number of successful extensions: 61 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -