BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_C02 (873 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 4.1 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 23 4.1 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 23 4.1 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 7.2 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 9.6 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -3 Query: 193 HHGLKLSLAPLAVLHSRPCCY 131 H G+ + P+ VLH P C+ Sbjct: 181 HMGVHRAKPPMRVLHQCPVCH 201 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 742 NFTNKAFFSLH 710 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 Query: 742 NFTNKAFFSLH 710 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +1 Query: 109 PTNPILSGNNMDVNVALQEVLKTALIHGGLVHGLHE 216 P N I+SGN + + + + + K G L + +++ Sbjct: 43 PVNDIISGNILPLYTSAENIFKQLREWGRLYYPIYK 78 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.4 bits (43), Expect = 9.6 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -1 Query: 318 FVAQSLNKFLVCG 280 F+ + NKF++CG Sbjct: 317 FLQEGANKFVICG 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,279 Number of Sequences: 336 Number of extensions: 2954 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24099889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -