BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B23 (973 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0171 - 1447782-1447935,1448016-1448480,1448578-1450004 29 7.4 08_01_0170 - 1440908-1441072,1441539-1441581,1442155-1442619,144... 29 7.4 >08_01_0171 - 1447782-1447935,1448016-1448480,1448578-1450004 Length = 681 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 7/31 (22%) Frame = -3 Query: 185 YQLTFWFFSSSRSFLQK-------PRPPKKP 114 +QLT W+F SS SF QK P PP P Sbjct: 253 HQLTSWYFKSSSSFEQKLAAKVASPPPPSSP 283 >08_01_0170 - 1440908-1441072,1441539-1441581,1442155-1442619, 1442714-1444149 Length = 702 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 7/31 (22%) Frame = -3 Query: 185 YQLTFWFFSSSRSFLQK-------PRPPKKP 114 +QLT W+F SS SF QK P PP P Sbjct: 256 HQLTSWYFKSSSSFEQKLAAKVASPPPPSSP 286 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,474,188 Number of Sequences: 37544 Number of extensions: 287831 Number of successful extensions: 686 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 686 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2823252340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -