BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B22 (947 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 26 6.7 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 26.2 bits (55), Expect = 6.7 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -3 Query: 153 KNLTASYLVKTINNTMMFTCFGILQHTNTKQNKERNLK 40 KNL A +K+ NNT+ I NT Q+ ++NL+ Sbjct: 523 KNLVAQKQLKSANNTLHVRAKHIQILENTNQSLKKNLE 560 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,839,469 Number of Sequences: 5004 Number of extensions: 23731 Number of successful extensions: 40 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 483319012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -