BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B21 (943 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 62 6e-10 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 60 3e-09 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 59 4e-09 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 59 4e-09 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 56 4e-08 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 56 5e-08 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 50 3e-06 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 49 5e-06 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 48 1e-05 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 45 1e-04 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 45 1e-04 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 43 3e-04 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 43 4e-04 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 42 5e-04 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 42 7e-04 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 42 0.001 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 41 0.001 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 40 0.003 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 40 0.003 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 39 0.005 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 38 0.012 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 38 0.016 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 38 0.016 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 37 0.027 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 33 0.033 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.036 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 36 0.036 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 36 0.036 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 36 0.036 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 36 0.047 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 36 0.047 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 36 0.047 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.047 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 36 0.063 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 35 0.083 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 35 0.11 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 34 0.14 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 34 0.19 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 34 0.19 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 34 0.19 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 33 0.25 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 33 0.25 SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) 33 0.25 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 33 0.33 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 33 0.33 SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) 33 0.44 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.44 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 32 0.59 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.77 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 32 0.77 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 31 1.0 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 31 1.0 SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) 31 1.0 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 1.0 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 31 1.0 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 31 1.0 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 31 1.8 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 31 1.8 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 31 1.8 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 31 1.8 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 1.8 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 30 2.4 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 30 3.1 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 30 3.1 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_28593| Best HMM Match : CUB (HMM E-Value=1.3e-14) 30 3.1 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 30 3.1 SB_14127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 4.0 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 29 4.1 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 29 4.1 SB_17315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 29 4.1 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.5 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 5.5 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 5.5 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 5.5 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 5.5 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 5.5 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 5.5 SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) 29 5.5 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 29 7.2 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 29 7.2 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 29 7.2 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 29 7.2 SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.2 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 29 7.2 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 29 7.2 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 28 9.5 SB_41909| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_55225| Best HMM Match : efhand (HMM E-Value=5.7e-12) 28 9.5 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 28 9.5 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 26 9.6 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 62.1 bits (144), Expect = 6e-10 Identities = 30/75 (40%), Positives = 30/75 (40%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 PPPPP PPPP PPP P PPPP P PP PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP----PPPPPPPPPPPPPPPPPPPPPPPAP 420 Query: 719 XXXXXPPXPPPPXXR 763 PP PPPP R Sbjct: 421 PPPPPPPPPPPPALR 435 Score = 52.4 bits (120), Expect = 5e-07 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = +2 Query: 566 GXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXP 745 G PPPP PPP P PPPP P PP PPP PP P Sbjct: 360 GINMSPPPPPPPPPPPPSPP------PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Query: 746 PPP 754 PPP Sbjct: 414 PPP 416 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPP P PPPP PPPP PPP P PPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 671 XPXPPXXXXGXPPP 712 P PP PP Sbjct: 428 PPPPPALRLACAPP 441 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXX 717 PP PP PPPP PPP PP PPPP PPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Query: 718 PXXXXPP 738 PP Sbjct: 435 RLACAPP 441 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 1/73 (1%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPP-PXXGAPPPX 714 PPPPP PPPP PPP PP PPP P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 715 XPXXXXPPXXPPP 753 P PP Sbjct: 429 PPPPALRLACAPP 441 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXX 834 PP PPPP PPP P PP PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP----------- 413 Query: 835 XXAGXPXPLPXXXPPXPPXPSXPP 906 P P P PP PP P PP Sbjct: 414 -----PPPPPAPPPPPPPPPPPPP 432 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/73 (28%), Positives = 22/73 (30%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXP 858 PPPP PPP P PP PPP P P Sbjct: 365 PPPP----PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Query: 859 LPXXXPPXPPXPS 897 P PP PP P+ Sbjct: 421 PPPPPPPPPPPPA 433 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P S PP P P PP P PPPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P PP P P PP P PPPPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P + P PP P P PP P PPPPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P + P PP P P PP P PPPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P + P PP P P PP P PPPPPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P PP P P + PP P PPPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P PP P P PP P PPPPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 244 APQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 +P P PP P P PP P PPPPPP Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P PP P P PP P PPPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P PP P P PP P PPPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P PP P P PP P PPPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P PP P P PP P PPPPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 31.9 bits (69), Expect = 0.77 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 413 PPPPPPAPPPPPPPPPPPP 431 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 382 PPPPPPSPPPPPQPPPPPP 400 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 268 NXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 N S PP P P + PP P PPPP P Sbjct: 362 NMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP 395 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPP 383 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPP 391 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 387 PSPPPPPQPPPPPPPPPPP 405 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPP 408 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 393 PQPPPPPPPPPPPPPPPPP 411 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 395 PPPPPPPPPPPPPPPPPPP 413 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPP 414 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPP 415 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPP 416 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPP 417 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPP 418 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 403 PPPPPPPPPPPPPPPPAPP 421 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 404 PPPPPPPPPPPPPPPAPPP 422 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 405 PPPPPPPPPPPPPPAPPPP 423 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 407 PPPPPPPPPPPPAPPPPPP 425 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 412 PPPPPPPAPPPPPPPPPPP 430 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPP 366 P P S PP P P PP P PPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P SP PP P PP P PPPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 SP PP P P PP P PPPPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P+ PP P P P P PPPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P+ PP P P PP P PPP PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P PP P P PP P PPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 636 GXSXXXPPRGGGXXPPPXXXGGXPPPXXXXXXXPXXPPP 752 G + PP PPP PPP P PPP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 370 PPPPPPPSPPPPPPPPPP 387 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSP 389 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 376 PSPPPPPPPPPPSPPPPP 393 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 415 PPPPAPPPPPPPPPPPPP 432 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 60.9 bits (141), Expect = 1e-09 Identities = 29/72 (40%), Positives = 29/72 (40%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 PPPPP GG PPPP P G PPPP GG PP PP Sbjct: 921 PPPPPPGGNAPL---PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Query: 719 XXXXXPPXPPPP 754 PP PPPP Sbjct: 978 GGSAPPPPPPPP 989 Score = 57.6 bits (133), Expect = 1e-08 Identities = 36/106 (33%), Positives = 39/106 (36%) Frame = +1 Query: 289 PXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXPP 468 P G+ P + PPPPPP G G+ P P GG PP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPP--GGNAPLPPPPPGGSAPSQPPP--PGGNAPPP 955 Query: 469 PXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPP 606 P PP GGG P PPP GG PPPP PPP Sbjct: 956 PPPPGGSAPPPGGGA-------PPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 57.6 bits (133), Expect = 1e-08 Identities = 33/96 (34%), Positives = 33/96 (34%), Gaps = 4/96 (4%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXP----PPPXPP 604 P G P PPP GG PPPPP G P PPP PP Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAP-----LPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Query: 605 PXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 P G PPPP G P PP PPP Sbjct: 959 PGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +2 Query: 635 GGVXXPPPPXGG-XPXPPXXXXGXPP--PXXXXXXXPPXPPPP 754 G V PPPP GG P PP G P P PP PPPP Sbjct: 917 GSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 35.1 bits (77), Expect = 0.083 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 PPP P GG G G PPPP G P P Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPP 988 Score = 34.3 bits (75), Expect = 0.14 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 4/95 (4%) Frame = +2 Query: 635 GGVXXPP--PPXGGXPXPPXXXXGXP--PPXXXXXXXPPXPPPPXXRGXXXXXXXXXXXX 802 GG P PP G P PP G PP P PPPP Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Query: 803 XXXXXXXXXXXXXXGXPXPSXXXXPPXPXPPXXPP 907 P P PP P PP PP Sbjct: 965 PPGGGAPPL------PPPPGGSAPPPPPPPPPPPP 993 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 2/61 (3%) Frame = -3 Query: 587 GGXXXXXXXPPXGGGGGXXXXXXX--PPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXA 414 GG PP G PPPPP G GG PP P G P Sbjct: 927 GGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 Query: 413 P 411 P Sbjct: 987 P 987 Score = 33.5 bits (73), Expect = 0.25 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXP--PPPPGGXXXPGXXP 410 PPP PGG G P PPPPGG P P Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = -2 Query: 669 PPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 PP GG PP GG P PP GG G PP GG Sbjct: 924 PPPGGNAPLPPPPPGGSAPSQPPPPGGNAPP---PPPPPGGSAPPPGGGAPPLPPPPGGS 980 Query: 489 KKXKXXXGXXPFPP 448 P PP Sbjct: 981 APPPPPPPPPPPPP 994 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Frame = +1 Query: 241 TAPQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXP------PPPPP 369 +AP + P + PP P P G+A PP P P PPPPP Sbjct: 940 SAPSQPPPPGGNAPPPPPP-PGGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = -3 Query: 515 PPPPPXGGXKKXKXX--GGGXXSPPXPXGXXXPGXAP 411 PPPPP GG GG S P P G P P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = -3 Query: 587 GGXXXXXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXP 423 GG PP G PPP GG GG PP P P Sbjct: 938 GGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 669 PPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 PP GG PP G GG P PP G P PPP G Sbjct: 946 PPPGGNAPPPPPPPG------GSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPPMRKLG 999 Query: 489 K 487 K Sbjct: 1000 K 1000 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = -3 Query: 560 PPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPX--GXXXP--GXAP 411 PP GG PPPPP G GG PP P G P G AP Sbjct: 924 PPPGGNA------PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAP 971 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = -2 Query: 585 GXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGGKKXKXXXGXX--PFPPXPXGAAXXRG 418 G P PP GG P PPP G G P PP P G+A G Sbjct: 916 GGSVPPPPPPPGGNA------PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPG 967 Score = 28.3 bits (60), Expect = 9.5 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 2/72 (2%) Frame = -3 Query: 515 PPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXAPXXXXXXXXFPPXXXGGG--GGGXXK 342 PPPPP GG PP P G P P PP G GG Sbjct: 920 PPPPPP--------PGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAP 971 Query: 341 GXRRVTGGXAAP 306 GG A P Sbjct: 972 PLPPPPGGSAPP 983 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 60.5 bits (140), Expect = 2e-09 Identities = 48/170 (28%), Positives = 49/170 (28%), Gaps = 1/170 (0%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPG 426 P SPN PP P P PP P PP PPP P Sbjct: 84 PPTNFSPNPPYPPPPYP-----PYPPPPPYPPPPNPPYPPP-PNAPYPPPPNPPYPPPPN 137 Query: 427 XXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPP 606 P PPP + PP P PPP PPPP PP Sbjct: 138 APYPPSPNAPYPPPPN--PPYPPP--------LYPPPPNPPPPNAPYPPPPYPPPPNPPY 187 Query: 607 XXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPP-PXXPXXXXPPXXPPP 753 PP PPPP PP P P PP PPP Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 55.2 bits (127), Expect = 7e-08 Identities = 31/92 (33%), Positives = 32/92 (34%), Gaps = 2/92 (2%) Frame = +2 Query: 485 FXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXP--PPXPXXXXXXXGGVXXPPP 658 + PPP P PPP P PPPP P PP P PPP Sbjct: 94 YPPPPYPP--YPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 659 PXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P P PPP PP PPPP Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 54.8 bits (126), Expect = 1e-07 Identities = 35/127 (27%), Positives = 35/127 (27%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 P PPPP PPPP PP P P PP P PP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 707 PPXXXXXXXPPXPPPPXXRGXXXXXXXXXXXXXXXXXXXXXXXXXXGXPXPSXXXXPPXP 886 PP P PPPP P P PP P Sbjct: 150 PPPNPPYPPPLYPPPPNP--PPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Query: 887 XPPXXPP 907 PP PP Sbjct: 208 NPPYPPP 214 Score = 54.4 bits (125), Expect = 1e-07 Identities = 38/142 (26%), Positives = 38/142 (26%), Gaps = 3/142 (2%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXP-PPXPXXXXXXXGGVXXPPPPXG 667 PPP P PP PP PPP P PP P PPPP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 668 GXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXR--GXXXXXXXXXXXXXXXXXXXXXXXXX 841 P P PPP PP PPPP Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Query: 842 XGXPXPSXXXXPPXPXPPXXPP 907 P P P P PP PP Sbjct: 215 PNAPNPPYPPPPNAPNPPYPPP 236 Score = 50.8 bits (116), Expect = 2e-06 Identities = 36/124 (29%), Positives = 37/124 (29%), Gaps = 2/124 (1%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPP--PXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPP 711 PPPPP PPP P PPP PP PPPP PPP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP---YPPSPNAPYPPPPNPPYPPP 159 Query: 712 XXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXPLPXXXPPXPPX 891 P PP PPP P P P PP PP Sbjct: 160 LYP----PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP-PPPNPPYPPP 214 Query: 892 PSXP 903 P+ P Sbjct: 215 PNAP 218 Score = 50.0 bits (114), Expect = 3e-06 Identities = 30/96 (31%), Positives = 31/96 (32%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVX 646 P + PPP P PPP PPPP PP P Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN--- 166 Query: 647 XPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPPP P PP P P PP PPPP Sbjct: 167 -PPPPNA--PYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/97 (30%), Positives = 31/97 (31%), Gaps = 1/97 (1%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVX 646 P + PPP P PPP PPPP PPP Sbjct: 126 PPPNPPYPPPP---NAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP---- 178 Query: 647 XPPPPXGGXPXPPXXXXGXPP-PXXXXXXXPPXPPPP 754 PPPP P PP PP PP PPPP Sbjct: 179 YPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/135 (23%), Positives = 32/135 (23%), Gaps = 4/135 (2%) Frame = +1 Query: 511 GGXXXXXXXPPPPPXGGXXXXXXXPPP----PXPPPXXXXXXXXXXGXRXXXPPXGGXXX 678 GG P PP PPP P PP PP Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPY 140 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXP 858 PP P PPP P P PPP P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 Query: 859 LPXXXPPXPPXPSXP 903 P PP PP P P Sbjct: 201 APNPPPPNPPYPPPP 215 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/122 (27%), Positives = 33/122 (27%), Gaps = 2/122 (1%) Frame = +2 Query: 548 PPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXX 727 PP PPP P P P PPPP P PP PPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPP-NPPYPPPPNAPYPPPPNPPY-PPPPNAPYP 141 Query: 728 XXP--PXPPPPXXRGXXXXXXXXXXXXXXXXXXXXXXXXXXGXPXPSXXXXPPXPXPPXX 901 P P PPPP P P PP P PP Sbjct: 142 PSPNAPYPPPP-----NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP 196 Query: 902 PP 907 PP Sbjct: 197 PP 198 Score = 33.9 bits (74), Expect = 0.19 Identities = 31/113 (27%), Positives = 32/113 (28%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPX 441 SPN PP P P PP P P PPPP P P Sbjct: 143 SPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP-----YPPPPNPPYPPPPNPPYPP 197 Query: 442 GXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXP 600 PPP + PP PPPP PPPP P Sbjct: 198 PPNAPNPPPPN--PPYPPPPNA-----PNPPYPPPP----NAPNPPYPPPPNP 239 Score = 33.5 bits (73), Expect = 0.25 Identities = 27/115 (23%), Positives = 28/115 (24%) Frame = +3 Query: 588 PPPPPPXXXXXXXXXXGXSXXXPPRGGGXXPPPXXXGGXPPPXXXXXXXPXXPPPXXXXG 767 PPPP P + PP PPP PPP P P P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN- 153 Query: 768 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 154 ----------PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVX 646 P + PPP P P PPP PP P PP P Sbjct: 173 PYPPPPYPPPPNP---PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Query: 647 XPPPPXGGXP 676 PP P P Sbjct: 230 NPPYPPPPNP 239 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 60.1 bits (139), Expect = 3e-09 Identities = 33/94 (35%), Positives = 33/94 (35%), Gaps = 6/94 (6%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPP------PPXPPPXPXXXXXXXGGVXXP 652 PPP G PPPPP G PP PP PPP P Sbjct: 289 PPPSRGAAPPPPSRGAPPPPP--SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 653 PPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPP G PP PPP PP PPPP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 58.0 bits (134), Expect = 1e-08 Identities = 37/113 (32%), Positives = 37/113 (32%), Gaps = 7/113 (6%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPX----PP 604 P G P PPP G P PP PPPP PP Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP 348 Query: 605 PXPXXXXXXXGGVXXPPPPX---GGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P GG PPPP GG P PP G PP PP PPPP Sbjct: 349 PSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP---SSLGNPPPPPPP 398 Score = 55.2 bits (127), Expect = 7e-08 Identities = 49/151 (32%), Positives = 51/151 (33%), Gaps = 2/151 (1%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXG 444 P S P P GA PP +R PPPPP G + P Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSR----GSAPPPPPARMGTAPPPPPPSRSSQ--RPPPPS 342 Query: 445 XGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXX 624 G PPP PP GG PPPPP GG PPP PPP Sbjct: 343 RGA---PPPPSMGMAPPPVGGAA-----PPPPPPPPVGG--------PPPPPPPI----- 381 Query: 625 XXXXGXRXXXPP--XGGXXXPPPPXXGAPPP 711 PP G PPPP GAPPP Sbjct: 382 -------EGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 52.0 bits (119), Expect = 7e-07 Identities = 31/92 (33%), Positives = 31/92 (33%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPP P PPPP G P PPP P GG PPPP G Sbjct: 329 PPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPV-----GGPPPPPPPIEG 383 Query: 671 XPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 P P PPP PP P P G Sbjct: 384 RP-PSSLGNPPPPPPPGRGAPPPGPMIPGRAG 414 Score = 50.4 bits (115), Expect = 2e-06 Identities = 37/118 (31%), Positives = 37/118 (31%), Gaps = 12/118 (10%) Frame = +1 Query: 451 GEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPP------XPPPXX 612 G PPP PP G PPP PPPP PPP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 613 XXXXXXXXGXRXXXPPXGG---XXXPPPPXXGAPPPXXPXXXXPP---XXPPPXXXXG 768 G PP GG PPPP G PPP P PP PPP G Sbjct: 344 GAPPPPSMG--MAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Score = 50.4 bits (115), Expect = 2e-06 Identities = 39/131 (29%), Positives = 39/131 (29%) Frame = +2 Query: 290 PXPXXGGPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXGXGGXGXXP 469 P P G PPPP P R P G P Sbjct: 289 PPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPS-RGAPP 347 Query: 470 XXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXX 649 PPP GG P PPPPP GG PPP PPP G Sbjct: 348 PPSMGMAPPPV--GGAAPPP---PPPPPVGG--------PPPPPPPIEGRPPSSLGNPPP 394 Query: 650 PPPPXGGXPXP 682 PPPP G P P Sbjct: 395 PPPPGRGAPPP 405 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 590 PPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP PP G PPP G P PP G PP PPPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 41.9 bits (94), Expect = 7e-04 Identities = 37/116 (31%), Positives = 38/116 (32%), Gaps = 4/116 (3%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPP----PPXXXGGXXXXXXXXXGAXPGXX 432 P+ P P P G A PP PPPP PP G GA P Sbjct: 309 PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVG--GAAPPPP 366 Query: 433 XPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXP 600 P GG PPP PP G PPPPP G PPP P Sbjct: 367 PPPPVGGPPPPPPPIEG--RPPSSLGN--------PPPPPPPG-----RGAPPPGP 407 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 588 PPPPPPXXXXXXXXXXGXSXXXPPRGGGXXPPPXXXGGXPPPXXXXXXXPXXPPP 752 PPPPP G P RG PPP G PPP PPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 40.7 bits (91), Expect = 0.002 Identities = 32/117 (27%), Positives = 33/117 (28%), Gaps = 7/117 (5%) Frame = +3 Query: 423 GXXXPPGGGGGXXPXPXPLXFFXPPPGXGGGXXXXXXXXXXXXXXXXXXXXXXXPPPP-- 596 G PP G P P PPP G PPPP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 597 --PPPXXXXXXXXXXGXSXXXPPRG---GGXXPPPXXXGGXPPPXXXXXXXPXXPPP 752 PPP G + PP GG PPP G PP P PPP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP--SSLGNPPPPPPP 398 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/96 (26%), Positives = 26/96 (27%), Gaps = 6/96 (6%) Frame = +2 Query: 638 GVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXP------PPPXXRGXXXXXXXXXXX 799 G+ PPPP G PP PPP PP P PPP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 800 XXXXXXXXXXXXXXXGXPXPSXXXXPPXPXPPXXPP 907 G P PP PP PP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 37.1 bits (82), Expect = 0.021 Identities = 23/82 (28%), Positives = 23/82 (28%), Gaps = 2/82 (2%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXX 834 PP G PPP APPP P PPP Sbjct: 299 PPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPV 358 Query: 835 XXAGXPXPLPXXX--PPXPPXP 894 A P P P PP PP P Sbjct: 359 GGAAPPPPPPPPVGGPPPPPPP 380 Score = 35.5 bits (78), Expect = 0.063 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +3 Query: 588 PPPPPPXXXXXXXXXXGXSXXXPPRGGGXXPPPXXXGGXPPPXXXXXXXPXXPPPXXXXG 767 PPPPPP PP G PP G PPP PPP G Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMG--MAPPPVGGAAPPPPPPPPVGGPPPPPPPIEG 383 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 59.3 bits (137), Expect = 4e-09 Identities = 55/209 (26%), Positives = 57/209 (27%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEX 459 PP P G+A PP R PPPPPP G+ P GE Sbjct: 194 PPPPPHSRHGSAPPPPERS---SGPPPPPPGRGPSQRSLAPPPTGS--SRPLPAPPPGEN 248 Query: 460 XPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXG 639 PPP P GG PPPP PP PP Sbjct: 249 RPPPP----MRGPTSGG--------EPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQ 296 Query: 640 XRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXX 819 P PPPP PPP P P PPP G Sbjct: 297 GPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP--LRGQIAPPPPPISKPPTSTR 354 Query: 820 XXXXXXXAGXPXPLPXXXPPXPPXPSXPP 906 P PL PP PP PP Sbjct: 355 SAPPPPPGRAPQPL--GGPPPPPPGRRPP 381 Score = 51.6 bits (118), Expect = 9e-07 Identities = 50/178 (28%), Positives = 50/178 (28%), Gaps = 9/178 (5%) Frame = +1 Query: 247 PQKERSPNXSXPPXPX-PLXXGAAXPPVTRRXPFXXPPP----PPPXXXGGXXXXXXXXX 411 P ERS PP P A PP P PPP PPP G Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP- 265 Query: 412 GAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXP-- 585 P P G PPP PP G PP PP P Sbjct: 266 ---PKNAPPPPKRGSSNPPP-------PPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLN 315 Query: 586 -PPPXPPPXXXXXXXXXXGXR-XXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 PP PPP R PP PP APPP P PPP Sbjct: 316 ATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 373 Score = 49.2 bits (112), Expect = 5e-06 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 3/91 (3%) Frame = +2 Query: 491 PPPXXG---GGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PPP G GG P PPPP G PPP P P G PP Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSN------PPPPPTRGPPSNSFTTQGPPL-PPS 303 Query: 662 XGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P PP PPP P PPPP Sbjct: 304 RDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 48.4 bits (110), Expect = 8e-06 Identities = 49/181 (27%), Positives = 51/181 (28%), Gaps = 19/181 (10%) Frame = +1 Query: 268 NXSXPPX---PXPLXXGAAXPPVTRRXPFXXPPP--PPPXXXGGXXXXXXXXXGAXPGXX 432 N S PP P P G + F PPP PP G Sbjct: 137 NSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPP 196 Query: 433 XPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPP----PXP 600 P G PPP PP G G PPP G PPP P P Sbjct: 197 PPHSRHGSAPPPPERSSG-PPPPPPGRGPSQRSLAPPPT---GSSRPLPAPPPGENRPPP 252 Query: 601 PPXXXXXXXXXXGXRXXXPP--XGGXXXPPPPXXGAP--------PPXXPXXXXPPXXPP 750 P + PP G PPPP G P PP P P PP Sbjct: 253 PMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 312 Query: 751 P 753 P Sbjct: 313 P 313 Score = 48.4 bits (110), Expect = 8e-06 Identities = 37/151 (24%), Positives = 37/151 (24%), Gaps = 5/151 (3%) Frame = +2 Query: 458 GXXPXXXXXFXPPPXXGG----GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXX 625 G P PPP G G PPPPP G P PP P Sbjct: 163 GSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGR 222 Query: 626 XXXGGVXXPPPPXGGXPXP-PXXXXGXPPPXXXXXXXPPXPPPPXXRGXXXXXXXXXXXX 802 PPP P P P PPP PPPP Sbjct: 223 GPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPP 282 Query: 803 XXXXXXXXXXXXXXGXPXPSXXXXPPXPXPP 895 G P P P P PP Sbjct: 283 PPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 313 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/101 (31%), Positives = 33/101 (32%), Gaps = 10/101 (9%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXP----PPPXPPPX---PXXXXXXXGGVXX 649 PPP G PP PP P PPP PP P G + Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 341 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXP---PXPPPPXXR 763 PPPP PP PPP P P PPPP R Sbjct: 342 PPPPIS---KPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 379 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 7/95 (7%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPP---PXPPPXPXXXXXXXGGVXXPPPP 661 PP P PPPP PPP PP P PPPP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 360 Query: 662 XGGXP----XPPXXXXGXPPPXXXXXXXPPXPPPP 754 G P PP G PP PP PPPP Sbjct: 361 PGRAPQPLGGPPPPPPGRRPP--SGKINPPPPPPP 393 Score = 41.9 bits (94), Expect = 7e-04 Identities = 58/232 (25%), Positives = 62/232 (26%), Gaps = 12/232 (5%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXG---AAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGA 417 P ER + P P G A PP P PPPP G G+ Sbjct: 107 PAGERKAAGAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDR--GGQLAKKPSQGS 164 Query: 418 XPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPP- 594 P P G+ PP F G PPPPP PPPP Sbjct: 165 FP----PPPPMGKPPPPSGNKPTF-------GNSRTSTNGPPPPPHS---RHGSAPPPPE 210 Query: 595 ---XPPPXXXXXXXXXXGXRXXXPPXGGXXXP---PPPXXGAPPPXXPXXXXPPXXPPPX 756 PPP R PP G P PPP PPP PPP Sbjct: 211 RSSGPPP---PPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK 267 Query: 757 XXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXPLPXXXPPXPPXP--SXPP 906 G P P P PP P + PP Sbjct: 268 NAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPP 319 Score = 37.5 bits (83), Expect = 0.016 Identities = 38/162 (23%), Positives = 38/162 (23%), Gaps = 7/162 (4%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXP----FXXPPPPP---PXXXGGXXXXXXX 405 P N PP P G PP P PPPPP P Sbjct: 241 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 300 Query: 406 XXGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXP 585 P PPP P G PPPPP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIA----PPPPPISKPPTSTRSA 356 Query: 586 PPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPP 711 PPP P PP G PPPP P Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 33.9 bits (74), Expect = 0.19 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVX 646 P PPP PPPPP G PPPP P P G + Sbjct: 333 PPLRGQIAPPPPPISKPPTSTRSAPPPPP-GRAPQPLGGPPPPPPGRRPPS-----GKIN 386 Query: 647 XPPPPXGGXPXP 682 PPPP P Sbjct: 387 PPPPPPPAMDKP 398 Score = 33.5 bits (73), Expect = 0.25 Identities = 36/146 (24%), Positives = 38/146 (26%), Gaps = 4/146 (2%) Frame = -3 Query: 719 GXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXXXXXXPPXGGGG 540 G GGG GGGG GG P G PP Sbjct: 80 GFSGGGGGSMGGGGLGGLFAGGMPKLRPAGERKAAGAGPRGPALKPPGFRTTAPPPKNSS 139 Query: 539 GXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXP--GXAPXXXXXXXXF--PPXX 372 PPPP G + K G PP P G P G P PP Sbjct: 140 --PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPP 197 Query: 371 XGGGGGGXXKGXRRVTGGXAAPXXRG 294 G R +G P RG Sbjct: 198 PHSRHGSAPPPPERSSGPPPPPPGRG 223 Score = 31.9 bits (69), Expect = 0.77 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 5/88 (5%) Frame = +2 Query: 506 GGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXG-----GVXXPPPPXGG 670 G G G P PP PPPP P P G PPPP G Sbjct: 115 GAGPRG-PALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGK 173 Query: 671 XPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P G P PPPP Sbjct: 174 PPPP----SGNKPTFGNSRTSTNGPPPP 197 Score = 30.7 bits (66), Expect = 1.8 Identities = 43/181 (23%), Positives = 45/181 (24%), Gaps = 11/181 (6%) Frame = +1 Query: 244 APQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPP-----------PPXXXGGXX 390 AP N + PP P P PP R PPPP PP G Sbjct: 307 APAPPPPLNATPPP-PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 365 Query: 391 XXXXXXXGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXX 570 PG P G PPP P G Sbjct: 366 QPLGGPPPPPPGRRPPSGKINPPPPPPPAMD--KPSFTNGPVSNNIMDSKNSFECRFNFR 423 Query: 571 XXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPP 750 PPP P + G P GAPPP P PP PP Sbjct: 424 TLNELPPPEP----YQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPP--PP 477 Query: 751 P 753 P Sbjct: 478 P 478 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 245 PPKRNEAXTXPXRRXPXPXXGGPPPPP 325 P A P R P P G PPPPP Sbjct: 350 PTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 587 PPPXPPPXPXXXXXXXGGVXXPPP 658 PPP PPP P G PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 599 PPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPP 748 PPP P G P P G PPP PP PP Sbjct: 429 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 478 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 511 PPXPGGGXKXXXGXGXGXXPPPPPGGXXXP 422 PP P G + G PPPPP G P Sbjct: 147 PPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 176 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPPP PPP P P PPP Sbjct: 2 PPPPPPPGPPP-PPSAPSGPVKPPP 25 Score = 28.3 bits (60), Expect = 9.5 Identities = 34/141 (24%), Positives = 35/141 (24%), Gaps = 10/141 (7%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXX 573 GGG GG G GG P G G R P Sbjct: 85 GGGSMGGGGLGGLFAGGMPKLRPAGER--KAAGAGPRGPALKPPGFRTTAPPPKNSSPPP 142 Query: 572 XXXXPPXGGGGG----XXXXXXXPPPPPXG------GXKKXKXXGGGXXSPPXPXGXXXP 423 PP GG PPPPP G G K + P P Sbjct: 143 PFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRH 202 Query: 422 GXAPXXXXXXXXFPPXXXGGG 360 G AP PP G G Sbjct: 203 GSAPPPPERSSGPPPPPPGRG 223 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 241 TAPQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 T P K + P P GA PPV P PPPPPP Sbjct: 440 TYPSKNQQKANRGNPRPASSSRGAP-PPVP---PSRGPPPPPP 478 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 59.3 bits (137), Expect = 4e-09 Identities = 55/209 (26%), Positives = 57/209 (27%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEX 459 PP P G+A PP R PPPPPP G+ P GE Sbjct: 106 PPPPPHSRHGSAPPPPERS---SGPPPPPPGRGPSQRSLAPPPTGS--SRPLPAPPPGEN 160 Query: 460 XPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXG 639 PPP P GG PPPP PP PP Sbjct: 161 RPPPP----MRGPTSGG--------EPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQ 208 Query: 640 XRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXX 819 P PPPP PPP P P PPP G Sbjct: 209 GPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP--LRGQIAPPPPPISKPPTSTR 266 Query: 820 XXXXXXXAGXPXPLPXXXPPXPPXPSXPP 906 P PL PP PP PP Sbjct: 267 SAPPPPPGRAPQPL--GGPPPPPPGRRPP 293 Score = 51.6 bits (118), Expect = 9e-07 Identities = 50/178 (28%), Positives = 50/178 (28%), Gaps = 9/178 (5%) Frame = +1 Query: 247 PQKERSPNXSXPPXPX-PLXXGAAXPPVTRRXPFXXPPP----PPPXXXGGXXXXXXXXX 411 P ERS PP P A PP P PPP PPP G Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP- 177 Query: 412 GAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXP-- 585 P P G PPP PP G PP PP P Sbjct: 178 ---PKNAPPPPKRGSSNPPP-------PPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLN 227 Query: 586 -PPPXPPPXXXXXXXXXXGXR-XXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 PP PPP R PP PP APPP P PPP Sbjct: 228 ATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPP 285 Score = 49.2 bits (112), Expect = 5e-06 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 3/91 (3%) Frame = +2 Query: 491 PPPXXG---GGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PPP G GG P PPPP G PPP P P G PP Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSN------PPPPPTRGPPSNSFTTQGPPL-PPS 215 Query: 662 XGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P PP PPP P PPPP Sbjct: 216 RDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 48.4 bits (110), Expect = 8e-06 Identities = 49/181 (27%), Positives = 51/181 (28%), Gaps = 19/181 (10%) Frame = +1 Query: 268 NXSXPPX---PXPLXXGAAXPPVTRRXPFXXPPP--PPPXXXGGXXXXXXXXXGAXPGXX 432 N S PP P P G + F PPP PP G Sbjct: 49 NSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPP 108 Query: 433 XPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPP----PXP 600 P G PPP PP G G PPP G PPP P P Sbjct: 109 PPHSRHGSAPPPPERSSG-PPPPPPGRGPSQRSLAPPPT---GSSRPLPAPPPGENRPPP 164 Query: 601 PPXXXXXXXXXXGXRXXXPP--XGGXXXPPPPXXGAP--------PPXXPXXXXPPXXPP 750 P + PP G PPPP G P PP P P PP Sbjct: 165 PMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPP 224 Query: 751 P 753 P Sbjct: 225 P 225 Score = 48.4 bits (110), Expect = 8e-06 Identities = 37/151 (24%), Positives = 37/151 (24%), Gaps = 5/151 (3%) Frame = +2 Query: 458 GXXPXXXXXFXPPPXXGG----GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXX 625 G P PPP G G PPPPP G P PP P Sbjct: 75 GSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGR 134 Query: 626 XXXGGVXXPPPPXGGXPXP-PXXXXGXPPPXXXXXXXPPXPPPPXXRGXXXXXXXXXXXX 802 PPP P P P PPP PPPP Sbjct: 135 GPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPP 194 Query: 803 XXXXXXXXXXXXXXGXPXPSXXXXPPXPXPP 895 G P P P P PP Sbjct: 195 PPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 225 Score = 46.0 bits (104), Expect = 4e-05 Identities = 32/101 (31%), Positives = 33/101 (32%), Gaps = 10/101 (9%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXP----PPPXPPPX---PXXXXXXXGGVXX 649 PPP G PP PP P PPP PP P G + Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 253 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXP---PXPPPPXXR 763 PPPP PP PPP P P PPPP R Sbjct: 254 PPPPIS---KPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRR 291 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 7/95 (7%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPP---PXPPPXPXXXXXXXGGVXXPPPP 661 PP P PPPP PPP PP P PPPP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 272 Query: 662 XGGXP----XPPXXXXGXPPPXXXXXXXPPXPPPP 754 G P PP G PP PP PPPP Sbjct: 273 PGRAPQPLGGPPPPPPGRRPP--SGKINPPPPPPP 305 Score = 41.9 bits (94), Expect = 7e-04 Identities = 58/232 (25%), Positives = 62/232 (26%), Gaps = 12/232 (5%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXG---AAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGA 417 P ER + P P G A PP P PPPP G G+ Sbjct: 19 PAGERKAAGAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDR--GGQLAKKPSQGS 76 Query: 418 XPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPP- 594 P P G+ PP F G PPPPP PPPP Sbjct: 77 FP----PPPPMGKPPPPSGNKPTF-------GNSRTSTNGPPPPPHS---RHGSAPPPPE 122 Query: 595 ---XPPPXXXXXXXXXXGXRXXXPPXGGXXXP---PPPXXGAPPPXXPXXXXPPXXPPPX 756 PPP R PP G P PPP PPP PPP Sbjct: 123 RSSGPPP---PPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPK 179 Query: 757 XXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXPLPXXXPPXPPXP--SXPP 906 G P P P PP P + PP Sbjct: 180 NAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPP 231 Score = 37.5 bits (83), Expect = 0.016 Identities = 38/162 (23%), Positives = 38/162 (23%), Gaps = 7/162 (4%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXP----FXXPPPPP---PXXXGGXXXXXXX 405 P N PP P G PP P PPPPP P Sbjct: 153 PAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPL 212 Query: 406 XXGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXP 585 P PPP P G PPPPP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIA----PPPPPISKPPTSTRSA 268 Query: 586 PPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPP 711 PPP P PP G PPPP P Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 33.9 bits (74), Expect = 0.19 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVX 646 P PPP PPPPP G PPPP P P G + Sbjct: 245 PPLRGQIAPPPPPISKPPTSTRSAPPPPP-GRAPQPLGGPPPPPPGRRPPS-----GKIN 298 Query: 647 XPPPPXGGXPXP 682 PPPP P Sbjct: 299 PPPPPPPAMDKP 310 Score = 31.9 bits (69), Expect = 0.77 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 5/88 (5%) Frame = +2 Query: 506 GGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXG-----GVXXPPPPXGG 670 G G G P PP PPPP P P G PPPP G Sbjct: 27 GAGPRG-PALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGK 85 Query: 671 XPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P G P PPPP Sbjct: 86 PPPP----SGNKPTFGNSRTSTNGPPPP 109 Score = 30.7 bits (66), Expect = 1.8 Identities = 43/181 (23%), Positives = 45/181 (24%), Gaps = 11/181 (6%) Frame = +1 Query: 244 APQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPP-----------PPXXXGGXX 390 AP N + PP P P PP R PPPP PP G Sbjct: 219 APAPPPPLNATPPP-PPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 277 Query: 391 XXXXXXXGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXX 570 PG P G PPP P G Sbjct: 278 QPLGGPPPPPPGRRPPSGKINPPPPPPPAMD--KPSFTNGPVSNNIMDSKNSFECRFNFR 335 Query: 571 XXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPP 750 PPP P + G P GAPPP P PP PP Sbjct: 336 TLNELPPPEP----YQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPP--PP 389 Query: 751 P 753 P Sbjct: 390 P 390 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 245 PPKRNEAXTXPXRRXPXPXXGGPPPPP 325 P A P R P P G PPPPP Sbjct: 262 PTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 599 PPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPP 748 PPP P G P P G PPP PP PP Sbjct: 341 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 390 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/77 (28%), Positives = 24/77 (31%), Gaps = 4/77 (5%) Frame = -3 Query: 512 PPPPXGGXKKXKXXGGGXXSPPXPXGXXXP--GXAPXXXXXXXXF--PPXXXGGGGGGXX 345 PPPP G + K G PP P G P G P PP G Sbjct: 59 PPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAP 118 Query: 344 KGXRRVTGGXAAPXXRG 294 R +G P RG Sbjct: 119 PPPERSSGPPPPPPGRG 135 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 511 PPXPGGGXKXXXGXGXGXXPPPPPGGXXXP 422 PP P G + G PPPPP G P Sbjct: 59 PPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 88 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 241 TAPQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 T P K + P P GA PPV P PPPPPP Sbjct: 352 TYPSKNQQKANRGNPRPASSSRGAP-PPVP---PSRGPPPPPP 390 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 56.0 bits (129), Expect = 4e-08 Identities = 31/87 (35%), Positives = 31/87 (35%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 P P G P PPPPP G PPPP PPP G PPPP Sbjct: 682 PLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP---------GCAGLPPPPPSP 732 Query: 671 XPXPPXXXXGXPPPXXXXXXXPPXPPP 751 P PPP PP PPP Sbjct: 733 QPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 55.2 bits (127), Expect = 7e-08 Identities = 31/75 (41%), Positives = 31/75 (41%), Gaps = 3/75 (4%) Frame = +2 Query: 539 PPPPPXGGX-GXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXG--GXPXPPXXXXGXPP 709 PPPPP G PPPP PPP P PPPP G G P PP P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP------PS 731 Query: 710 PXXXXXXXPPXPPPP 754 P PP PPPP Sbjct: 732 PQPGCAGLPPPPPPP 746 Score = 42.3 bits (95), Expect = 5e-04 Identities = 36/120 (30%), Positives = 43/120 (35%) Frame = +1 Query: 241 TAPQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAX 420 T+ ++E+ PP P P+ G++ P PPPPPP G Sbjct: 666 TSQEQEKLKKVPPPPPPLPVIEGSSLS-----VPPPPPPPPPPLLSGTLPMPP------- 713 Query: 421 PGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXP 600 P P G G PPP P G G PPPPP G PPPP P Sbjct: 714 PPPPPPPGCAGLPPPPPS------PQPGCAG----LPPPPPPPPPG----CAGLPPPPPP 759 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXX-GAPPPX 714 PPPPP PPPP PPP + PPPP G PPP Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Query: 715 XP 720 P Sbjct: 758 PP 759 Score = 36.3 bits (80), Expect = 0.036 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = +2 Query: 590 PPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 PP PPP P + PPPP P PP P P PP PPPP G Sbjct: 677 PPPPPPLPVIEG---SSLSVPPPPP--PPPPPLLSGTLPMP------PPPPPPPPGCAG 724 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 PPP G G P PPPPP G PPP P P Sbjct: 728 PPPSPQPGCAGLPP--PPPPPPPGCAGLPPPPPPIDVPMKP 766 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 55.6 bits (128), Expect = 5e-08 Identities = 29/85 (34%), Positives = 29/85 (34%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPP G PPPPP PPPP P PPPP GG Sbjct: 140 PPPPIAPATGG-----PPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGG 194 Query: 671 XPXPPXXXXGXPPPXXXXXXXPPXP 745 P PP PPP PP P Sbjct: 195 PPPPPPPPPPPPPPPILELAAPPPP 219 Score = 52.0 bits (119), Expect = 7e-07 Identities = 36/116 (31%), Positives = 36/116 (31%), Gaps = 10/116 (8%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXP-PPPPXGGXGXXXXXPPPPXP---- 601 P G P P P P P PPPP PPPP Sbjct: 90 PAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATG 149 Query: 602 -PPXPXXXXXXXGGVXXPPP--PXGGXPXP--PXXXXGXPPPXXXXXXXPPXPPPP 754 PP P GG PPP P P P P PPP PP PPPP Sbjct: 150 GPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 49.2 bits (112), Expect = 5e-06 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXX 717 PPPPP PPPP P PP GG PPPP PPP Sbjct: 151 PPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGG---PPPPPPPPPPPPP 207 Query: 718 PXXXXPPXXPPPXXXXG 768 P PPP G Sbjct: 208 PPILELAAPPPPGSVLG 224 Score = 48.0 bits (109), Expect = 1e-05 Identities = 34/102 (33%), Positives = 34/102 (33%), Gaps = 14/102 (13%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXP----PPXPXXXXXXXGGVXXPPP 658 PPP PPPPP PPP P PP P GG PPP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 659 --PXGGXPXP--------PXXXXGXPPPXXXXXXXPPXPPPP 754 P P P P G PPP PP PPPP Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPP--PPPPPPPPPPPP 209 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/83 (31%), Positives = 26/83 (31%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPP G P PPPPP PPP P PPP G Sbjct: 139 PPPPPIAPATGGP---PPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP 195 Query: 671 XPXPPXXXXGXPPPXXXXXXXPP 739 P PP PPP PP Sbjct: 196 PPPPPPPPPPPPPPILELAAPPP 218 Score = 44.8 bits (101), Expect = 1e-04 Identities = 29/105 (27%), Positives = 29/105 (27%) Frame = +2 Query: 593 PXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRGXX 772 P PPP P PPPP P P PPP P PPPP Sbjct: 108 PTPPPPP-RAPETPSQAPSPPPP----PTSPATRAPPPPPPIAPATGGPPPPPPIAPATG 162 Query: 773 XXXXXXXXXXXXXXXXXXXXXXXXGXPXPSXXXXPPXPXPPXXPP 907 P PS PP P PP PP Sbjct: 163 GPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 39.5 bits (88), Expect = 0.004 Identities = 32/122 (26%), Positives = 35/122 (28%), Gaps = 6/122 (4%) Frame = +1 Query: 247 PQKERSPNXSXPPXPX----PLXXGAAXPPVTRRXPFXXPPPPP--PXXXGGXXXXXXXX 408 P +S + PP P P + PP T PPPPP P G Sbjct: 100 PMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Query: 409 XGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPP 588 P P P PP GG PPPPP PP Sbjct: 160 ATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP--PILELAAPP 217 Query: 589 PP 594 PP Sbjct: 218 PP 219 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 245 PPKRNEAXTXPXRRXPX-PXXGGPPPPP 325 PP + A P P P GGPPPPP Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPP 155 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 54.4 bits (125), Expect = 1e-07 Identities = 49/176 (27%), Positives = 50/176 (28%), Gaps = 8/176 (4%) Frame = +1 Query: 250 QKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPP--PPPPXXXGGXXXXXXXXXGAXP 423 Q+ R P P P P PP P PP P P G GA Sbjct: 419 QRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 478 Query: 424 GXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPP--PPXGGXXXXXXXPPPPX 597 P G PPP PP G P P PP G P P Sbjct: 479 PRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 538 Query: 598 P---PPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXP-PXXPPP 753 P PP G P G P P GAP P P P P PPP Sbjct: 539 PRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPP 594 Score = 50.4 bits (115), Expect = 2e-06 Identities = 56/220 (25%), Positives = 56/220 (25%), Gaps = 5/220 (2%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPP--PPPPXXXGGXXXXXXXXXGAXPGXXX 435 SP S P P P PP PP P P G GA Sbjct: 393 SPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVP 452 Query: 436 PXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPP--PPXGGXXXXXXXPPPPXPPPX 609 P G PPP PP G P P PP G P PPP Sbjct: 453 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA-------PHQRVPPPG 505 Query: 610 XXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXP-PXXPPPXXXXGXXXXXX 786 G P G P P GAP P P P P PPP Sbjct: 506 APHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPG 565 Query: 787 XXXXXXXXXXXXXXXXXXAGXPXPLPXXXPPXPPXPSXPP 906 G P P PP P P PP Sbjct: 566 APHPRVPPPGAPHPRVPPPGTPHP--RVPPPGAPHPKVPP 603 Score = 49.6 bits (113), Expect = 4e-06 Identities = 46/171 (26%), Positives = 47/171 (27%), Gaps = 8/171 (4%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPP--PPPPXXXGGXXXXXXXXXGAXPGXXXP 438 P P P P PP P PP P P G GA P Sbjct: 434 PGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 493 Query: 439 XGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPP--PPXGGXXXXXXXPPPPXP---P 603 G + PPP PP G P P PP G P P P P Sbjct: 494 PGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 553 Query: 604 PXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXP-PXXPPP 753 P G P G P P G P P P P P PPP Sbjct: 554 PGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 42.7 bits (96), Expect = 4e-04 Identities = 45/171 (26%), Positives = 45/171 (26%), Gaps = 8/171 (4%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPP--PPPPXXXGGXXXXXXXXXGAXPGXXXP 438 P P P P PP P PP P P G GA P Sbjct: 454 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPP 513 Query: 439 XGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPP--PPXGGXXXXXXXPP---PPXPP 603 G PPP PP G P P PP G P P PP Sbjct: 514 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPP 573 Query: 604 PXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXP-XXXXPPXXPPP 753 P G P G P P GAP P P PPP Sbjct: 574 PGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPP 624 Score = 41.9 bits (94), Expect = 7e-04 Identities = 41/163 (25%), Positives = 41/163 (25%), Gaps = 6/163 (3%) Frame = +1 Query: 436 PXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPP--PPXGGXXXXXXXPPPPXP--- 600 P G PPP P G P P PP G P P P Sbjct: 373 PPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVP 432 Query: 601 PPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXP-PXXPPPXXXXGXXX 777 PP G P G P P GAP P P P P PPP Sbjct: 433 PPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 492 Query: 778 XXXXXXXXXXXXXXXXXXXXXAGXPXPLPXXXPPXPPXPSXPP 906 G P P PP P P PP Sbjct: 493 PPGAPHQRVPPPGAPHPRVPPPGAPH--PRVPPPGAPHPRVPP 533 Score = 37.9 bits (84), Expect = 0.012 Identities = 42/164 (25%), Positives = 42/164 (25%), Gaps = 7/164 (4%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPP--PPPPXXXGGXXXXXXXXXGAXPGXXXP 438 P P P P PP P PP P P G GA P Sbjct: 484 PGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 543 Query: 439 XGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPP-PXGGXXXXXXXPP----PPXPP 603 G PPP PP G P P P G PP P PP Sbjct: 544 PGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPP 603 Query: 604 PXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXP 735 P G P P PP PPP P P Sbjct: 604 PGAPYQRLPYSGAYHPRLP-----PPGPPYQRVPPPGAPIQRVP 642 Score = 37.5 bits (83), Expect = 0.016 Identities = 44/171 (25%), Positives = 44/171 (25%), Gaps = 9/171 (5%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPP--PPPPXXXGGXXXXXXXXXGAXPGXXXP 438 P P P P PP PP P P G GA P Sbjct: 474 PGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 533 Query: 439 XGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPP--PPXGGXXXXXXXPPPPXPPPXX 612 G PPP PP G P P PP G P P PPP Sbjct: 534 PGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGA-------PHPRVPPPGT 586 Query: 613 XXXXXXXXGXRXXXPPXGGXXXPPPPXXGA-----PPPXXPXXXXPPXXPP 750 G P G P GA PPP P PP P Sbjct: 587 PHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAP 637 Score = 31.1 bits (67), Expect = 1.4 Identities = 28/113 (24%), Positives = 28/113 (24%), Gaps = 2/113 (1%) Frame = +2 Query: 419 PRXXAAPXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPP--PPXGGXGXXXXXPPP 592 P P G P PP P P P PP G PPP Sbjct: 407 PHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAP--HPRVPPP 464 Query: 593 PXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 P P V P P P P PPP PP P Sbjct: 465 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 29.5 bits (63), Expect = 4.1 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 4/69 (5%) Frame = +1 Query: 544 PPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGG--XXXPPP--PXXGAPPP 711 PPP G PPPP P G P G PPP P A PP Sbjct: 317 PPP--GMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPP 374 Query: 712 XXPXXXXPP 738 P PP Sbjct: 375 GEPYARMPP 383 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 54.0 bits (124), Expect = 2e-07 Identities = 33/88 (37%), Positives = 33/88 (37%), Gaps = 3/88 (3%) Frame = +2 Query: 512 GXXGXPXXXPPPPPXGGXGXXXXXPPPPX---PPPXPXXXXXXXGGVXXPPPPXGGXPXP 682 G G PPPPP PPPP PPP P PPPP G P P Sbjct: 337 GTSGGGGVNPPPPPTNNP----PSPPPPTNNTPPPPPPTNKPPP-----PPPPTNGPPPP 387 Query: 683 PXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 P G PPP PP PPP G Sbjct: 388 PPPTNGPPPPPPPTNGPPP--PPPPTNG 413 Score = 52.4 bits (120), Expect = 5e-07 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 3/84 (3%) Frame = +2 Query: 509 GGXXGXPXXXPPPPPXGGXGXXXXXPPPP---XPPPXPXXXXXXXGGVXXPPPPXGGXPX 679 G G PPPP PPPP PPP P PPPP G P Sbjct: 337 GTSGGGGVNPPPPPTNN-----PPSPPPPTNNTPPPPPPTNKP-----PPPPPPTNGPPP 386 Query: 680 PPXXXXGXPPPXXXXXXXPPXPPP 751 PP G PPP PP PPP Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 48.8 bits (111), Expect = 6e-06 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 3/80 (3%) Frame = +1 Query: 505 GGGGXXXXXXXPPPP---PXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXX 675 GGGG PPPP P PPPP P G PP G Sbjct: 340 GGGGVNP----PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP 395 Query: 676 XPPPPXXGAPPPXXPXXXXP 735 PPPP G PPP P P Sbjct: 396 PPPPPTNGPPPPPPPTNGPP 415 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPP P PPPP PP PPP P G PPPP G Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP----PPTNGPPPPPPPTNG 403 Query: 671 XPXPPXXXXGXP 706 P PP G P Sbjct: 404 PPPPPPPTNGPP 415 Score = 34.7 bits (76), Expect = 0.11 Identities = 25/88 (28%), Positives = 25/88 (28%) Frame = +1 Query: 442 GXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXX 621 G G PPP PP PPPP PPP PP Sbjct: 341 GGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPP----- 395 Query: 622 XXXXXGXRXXXPPXGGXXXPPPPXXGAP 705 PP G PPPP G P Sbjct: 396 --------PPPPPTNGPPPPPPPTNGPP 415 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXG 381 P + PP P P G PP P PPPPPP G Sbjct: 369 PPTNKPPPPPPPTNGPPPPP----PPTNGPPPPPPPTNG 403 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXG 381 P + PP P P G PP P PPPPPP G Sbjct: 379 PPTNGPPPPPPPTNGPPPPP----PPTNGPPPPPPPTNG 413 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +1 Query: 283 PXPXPLXXGAAXPPVTRRXPFXXP----PPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXG 450 P P P + PP T P P PPPPP G G P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP---PPPPTN 402 Query: 451 GEXXPPP 471 G PPP Sbjct: 403 GPPPPPP 409 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXG 381 P P + PP P P PP P PPPPPP G Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPP-----PTNGPPPPPPPTNG 393 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/68 (27%), Positives = 21/68 (30%), Gaps = 4/68 (5%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPP----PPPPXXXGGXXXXXXXXXGAXPGXX 432 P + P P P PP T + P PP PPPP G G P Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Query: 433 XPXGXGGE 456 G E Sbjct: 410 PTNGPPSE 417 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 PPP P G G PPPPP P P Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 290 PXPXXGGPPPPP*XDGXPS 346 P P G PPPPP +G PS Sbjct: 398 PPPTNGPPPPPPPTNGPPS 416 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = -3 Query: 515 PPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXAP 411 PPPPP G G PP P P P Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 52.4 bits (120), Expect = 5e-07 Identities = 36/109 (33%), Positives = 36/109 (33%), Gaps = 8/109 (7%) Frame = +2 Query: 443 GXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXP-----PPPPXGGXGXXXXXPPPPXPPP 607 G GG P PPP G G P PPPP G G PPPP Sbjct: 498 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQG---GGPPPPGAGQ 554 Query: 608 XPXXXXXXXGGVXXPPPP---XGGXPXPPXXXXGXPPPXXXXXXXPPXP 745 G PPPP GG P P G PPP PP P Sbjct: 555 GWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Score = 52.0 bits (119), Expect = 7e-07 Identities = 40/131 (30%), Positives = 40/131 (30%), Gaps = 2/131 (1%) Frame = -3 Query: 752 GGGXXGGXXXXGXX-GGGAPXXGGG-GXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGX 579 G G GG G GGG P G G G PP G P GGG G Sbjct: 496 GAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQ---GGGPPPPGA 552 Query: 578 XXXXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXAPXXXX 399 PP G G G PPPP G G G PP P G P Sbjct: 553 GQGWGQPPPGAGQGGG------PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAG 606 Query: 398 XXXXFPPXXXG 366 PP G Sbjct: 607 QGWGLPPPGSG 617 Score = 50.4 bits (115), Expect = 2e-06 Identities = 39/133 (29%), Positives = 40/133 (30%), Gaps = 3/133 (2%) Frame = +1 Query: 379 GGXXXXXXXXXGAXPGXXXPX---GXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPP 549 GG GA G P G GG PP + PP G G G PPP Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG------PPP 538 Query: 550 PXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXX 729 P G PPPP PP G PPPP G P P Sbjct: 539 PGAGQGGG---PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAG 595 Query: 730 XPPXXPPPXXXXG 768 PPP G Sbjct: 596 QGGGPPPPGAGQG 608 Score = 49.6 bits (113), Expect = 4e-06 Identities = 40/128 (31%), Positives = 40/128 (31%), Gaps = 18/128 (14%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXG--------XXXXXPPP 592 P G G G P PP G G G P PPP G G PPP Sbjct: 484 PGGGQGWGQPPPGAGQGGGPPPPGAGQGGGP-----PPPGAGQGWGQPPPGAGQGGGPPP 538 Query: 593 PXPPPXPXXXXXXXGGVXXPPPP---XGGXPXPPXXXXGXPPPXXXXXXXPPXP------ 745 P G PPP GG P PP G PPP PP P Sbjct: 539 PGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGG 598 Query: 746 -PPPXXRG 766 PPP G Sbjct: 599 GPPPPGAG 606 Score = 49.2 bits (112), Expect = 5e-06 Identities = 41/131 (31%), Positives = 41/131 (31%), Gaps = 1/131 (0%) Frame = -2 Query: 765 PRXXGGGGXGGXXXXXXXGGGXPXXXXG-GXGXPPXGGGGXXTPPXXXXXXXGXGGGXGG 589 P G G G GGG P G G G PP G G PP G GGG Sbjct: 493 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP---PPGAGQGGGPPP 549 Query: 588 GGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGGKKXKXXXGXXPFPPXPXGAAXXRGXXX 409 G PP G G G G P PPP G G G PP G Sbjct: 550 PGAGQGWGQPPPGAGQG---GGP--PPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPG 604 Query: 408 XXXXXXXXPPG 376 PPG Sbjct: 605 AGQGWGLPPPG 615 Score = 46.4 bits (105), Expect = 3e-05 Identities = 42/135 (31%), Positives = 42/135 (31%), Gaps = 3/135 (2%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGG---GGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGG 582 GGG G G GG P G GG PP G P G G GGG Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPP--------GAGQGGG- 535 Query: 581 XXXXXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXAPXXX 402 PP G G G PPPP G G G P P G G P Sbjct: 536 ------PPPPGAGQGGG-----PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGA 584 Query: 401 XXXXXFPPXXXGGGG 357 PP GGG Sbjct: 585 GQEGPPPPGAGQGGG 599 Score = 46.0 bits (104), Expect = 4e-05 Identities = 37/118 (31%), Positives = 38/118 (32%), Gaps = 6/118 (5%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPX--GGGGXXTPPXXXXXXXGXGGGXGGGGX 580 GG G G GGG P G G PP G G PP G GGG G Sbjct: 486 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPP----PGAGQGGGPPPPGA 541 Query: 579 XXXXPXPPXGGGGGXXXGXP----XXPPPXXGGGKKXKXXXGXXPFPPXPXGAAXXRG 418 PP G G G P PP G G+ G P P GA G Sbjct: 542 GQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGG 599 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/104 (30%), Positives = 32/104 (30%), Gaps = 3/104 (2%) Frame = -1 Query: 712 GGGXPPXXXG--GGXXPPPRG-GXXXDXPXXXXXXXXXXGGGGGGGXXXXXXXXXXXXXX 542 GGG PP G GG PP G G P G G GG Sbjct: 500 GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 Query: 541 XXXXXXPXXPPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 PPP PG G G G PPPPG G P Sbjct: 560 PPGAGQGGGPPP-PGAGQGGPPPPGAGQEGPPPPGAGQGGGPPP 602 Score = 38.7 bits (86), Expect = 0.007 Identities = 38/131 (29%), Positives = 38/131 (29%), Gaps = 11/131 (8%) Frame = -3 Query: 605 GGGXGGG----GXXXXXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPX 438 GGG G G G PP G G G PPPP G G G P P Sbjct: 485 GGGQGWGQPPPGAGQGGGPPPPGAGQGGG-----PPPPGAGQGWGQPPPGAGQGGGPPPP 539 Query: 437 GXXXPGXAPXXXXXXXXFPPXXXGGGGGGXXK------GXRRVTGGXAAPXXRGXG-XGG 279 G G P P G GGG G G P G G GG Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPGAGQGGG 599 Query: 278 XEXXGLRSFWG 246 G WG Sbjct: 600 PPPPGAGQGWG 610 Score = 38.3 bits (85), Expect = 0.009 Identities = 41/135 (30%), Positives = 41/135 (30%), Gaps = 4/135 (2%) Frame = +1 Query: 361 PPPXXXGGXXXXXXXXXGAXPGXXXP-XGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXX 537 PPP G G G P G GG PP PP G G G Sbjct: 503 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG----- 557 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPP---XXGAPP 708 PPP G PPPP G PP G PPPP G PP Sbjct: 558 -QPPPGAG---QGGGPPPP------------GAGQGGPPPPGAGQEGPPPPGAGQGGGPP 601 Query: 709 PXXPXXXXPPXXPPP 753 P P PPP Sbjct: 602 P--PGAGQGWGLPPP 614 Score = 37.1 bits (82), Expect = 0.021 Identities = 32/102 (31%), Positives = 33/102 (32%), Gaps = 1/102 (0%) Frame = -2 Query: 681 GXGXPPXGGG-GXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPP 505 G G PP G G G PP G GGG G PP G G G G P PPP Sbjct: 489 GWGQPPPGAGQGGGPPP----PGAGQGGGPPPPGAGQGWGQPPPGAGQG---GGP--PPP 539 Query: 504 XXGGGKKXKXXXGXXPFPPXPXGAAXXRGXXXXXXXXXXXPP 379 G G + P GA G PP Sbjct: 540 GAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPP 581 Score = 35.5 bits (78), Expect = 0.063 Identities = 32/99 (32%), Positives = 32/99 (32%) Frame = -2 Query: 675 GXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXG 496 G P GG G PP G GGG G PP G G G G P PP Sbjct: 481 GKVPGGGQGWGQPP----PGAGQGGGPPPPGAGQGGGPPPPGAGQG--WGQP--PPGAGQ 532 Query: 495 GGKKXKXXXGXXPFPPXPXGAAXXRGXXXXXXXXXXXPP 379 GG G PP P GA G PP Sbjct: 533 GGGPPPPGAGQGGGPP-PPGAGQGWGQPPPGAGQGGGPP 570 Score = 35.5 bits (78), Expect = 0.063 Identities = 30/101 (29%), Positives = 30/101 (29%) Frame = +1 Query: 289 PXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXPP 468 P P PP PPPP G G P P G G PP Sbjct: 526 PPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPP----PPGAGQGGPPP 581 Query: 469 PXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPP 591 P PP G G G PPPP G PPP Sbjct: 582 PGAGQEGPPPPGAGQGGG------PPPPGAG--QGWGLPPP 614 Score = 28.7 bits (61), Expect = 7.2 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = -3 Query: 479 KXXGGGXXSPPXPXGXXXPGXAPXXXXXXXXFPPXXXGGGGGGXXKGXRRVTGGXAAPXX 300 K GGG P G G P PP G G G GG P Sbjct: 482 KVPGGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAG-QGGGPPPPG 540 Query: 299 RGXGXGGXEXXGLRSFWG 246 G G GG G WG Sbjct: 541 AGQG-GGPPPPGAGQGWG 557 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 50.0 bits (114), Expect = 3e-06 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP--XGGXPXPPXXXXG 700 P PPPPP G PPP PPP P GG PPPP GG P PP G Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLP-------GGAAPPPPPPIGGGAPPPPPPGFG 708 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +2 Query: 587 PPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 PPP PPP P G PPP P PP PPP P PPPP G Sbjct: 660 PPPPPPPPP------GGQAGGAPPP----PPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPP GG G PPPP GG PPPP P GG PPPP G Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAA-----PPPPPP---------IGGGAPPPPPPGFG 708 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +1 Query: 583 PPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXG--APPPXXPXXXXPPXXPPP 753 PPPP PPP G PP PPPP G APPP P P PPP Sbjct: 660 PPPPPPPPPG--------GQAGGAPPP-----PPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 36.7 bits (81), Expect = 0.027 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = +1 Query: 340 PFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGX 519 P PPPPPP GG GA P P G PP PP GGG Sbjct: 656 PEAGPPPPPPPPPGGQAG------GAPPPPPPPLPGGAAPPPP--------PPIGGGA-- 699 Query: 520 XXXXXXPPPPPXG 558 PPPPP G Sbjct: 700 ------PPPPPPG 706 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXG 381 PP P PL GAA PP PPPPPP G Sbjct: 677 PPPPPPLPGGAAPPPPPPIGG-GAPPPPPPGFGG 709 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 244 APQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXG 381 A E P PP P GA PP PPPPPP G Sbjct: 653 AATPEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGG 698 Score = 33.1 bits (72), Expect = 0.33 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXG---AAXPPVTRRXPFXXPPPPPPXXXGG 384 +P PP P P G A PP P PPPPP GG Sbjct: 655 TPEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGG 698 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGG 434 PPP PGG G PPPPP G Sbjct: 680 PPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 560 PPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXG 435 PP GG PPP P G GG PP P G Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 658 PXGGXXXPPPPXXG-----APPPXXPXXXXPPXXPPPXXXXG 768 P G PPPP G APPP P PPP G Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGG 697 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -2 Query: 567 PXPPXGGGGGXXXGXPXXPPPXXGGG---KKXKXXXGXXPFPPXP 442 P PP GG G P PPP GG G P PP P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 PPP PGG G PPP PGG P P Sbjct: 664 PPPPPGG----QAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 29.5 bits (63), Expect = 4.1 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 454 EXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPP-----PXPPP 606 E PPP PP GG G PPPPP PPP P PPP Sbjct: 657 EAGPPPPP----PPPPGGQAGGAP----PPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +3 Query: 411 GXXPGXXXPPGGGGGXXPXPXPLXFF---XPPPGXGG 512 G P PP GG P P P+ PPPG GG Sbjct: 673 GGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPGFGG 709 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 49.2 bits (112), Expect = 5e-06 Identities = 32/88 (36%), Positives = 32/88 (36%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGGG GG GGG GG G GGGG G GGG G GG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGD------GGGYGDGGGFGDGGGYA 843 Query: 573 XXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GGGGG G GGG Sbjct: 844 DGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 48.4 bits (110), Expect = 8e-06 Identities = 32/88 (36%), Positives = 32/88 (36%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGGG GG GGG GG G GGGG G GGG GGGG Sbjct: 771 GGGGDGGDGGGGGDGGGG-----GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Query: 573 XXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GGG G G GGG Sbjct: 826 DGGGYGDGGGFGDGGGYADGDGGGGGGG 853 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPX-GGGGXXTPPXXXXXXXGXGGGXGGGGXX 577 GGGG GG GGG GG G G GG G GGG GGGG Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Query: 576 XXXPXPPXGGGGGXXXG 526 GGGGG G Sbjct: 859 GGGGGGGGGGGGGGGGG 875 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/88 (34%), Positives = 30/88 (34%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GG G GG GGG GG G GGGG G GGG G GG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG----GGGGGGGDGGGYGDGGGFG 837 Query: 573 XXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG G GGG Sbjct: 838 DGGGYADGDGGGGGGGGGGGGGGGGGGG 865 Score = 38.3 bits (85), Expect = 0.009 Identities = 28/92 (30%), Positives = 28/92 (30%) Frame = -3 Query: 737 GGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXXXXXXP 558 GG G GGG GGGG GG GGG GGGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG- 828 Query: 557 PXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGG 462 G GGG GG GGG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 711 GGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXX 532 GGG GG G GGGG G GGG GGGG GGGGG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGG----------GGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Query: 531 XG 526 G Sbjct: 820 GG 821 Score = 36.7 bits (81), Expect = 0.027 Identities = 30/108 (27%), Positives = 30/108 (27%) Frame = -3 Query: 602 GGXGGGGXXXXXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXP 423 GG GGG GGGGG GG GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 422 GXAPXXXXXXXXFPPXXXGGGGGGXXKGXRRVTGGXAAPXXRGXGXGG 279 G GGGGGG G GG G G GG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 36.7 bits (81), Expect = 0.027 Identities = 42/149 (28%), Positives = 42/149 (28%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXX 573 GGG GG G GGG GGGG GG GGG GGGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGG-----GGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Query: 572 XXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXAPXXXXXX 393 GGG G GG GGG G G Sbjct: 826 DGGGYGDGGGFGDG-----------GGYADGDGGGGGGGGGGGGGGGGGGGGG------- 867 Query: 392 XXFPPXXXGGGGGGXXKGXRRVTGGXAAP 306 GGGGGG K T P Sbjct: 868 -----GGGGGGGGGVIKNEESSTDQQKGP 891 Score = 31.9 bits (69), Expect = 0.77 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 660 GGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GGGG G GGG GGGG GGGGG G GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGG-------GGGGGGDGGGYGDGDGGGGGGG 818 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 751 GGGXXGXXXXXXXGGGXPPXXXGGGXXPPPRGGXXXDXPXXXXXXXXXXGGGGGGG 584 GGG G GGG GGG GG D GGGGGGG Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGG-----GGGGGDGGGYGDGDGGGGGGGGGGG 822 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 49.2 bits (112), Expect = 5e-06 Identities = 27/72 (37%), Positives = 28/72 (38%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 P PPP G PPP PP P + PPPP G P PP PPP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKF------MGLPPPPPGMRPMPPQPPF-MPPPPR 1274 Query: 719 XXXXXPPXPPPP 754 PP PP P Sbjct: 1275 MQPPGPPGPPGP 1286 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = +1 Query: 541 PPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPP--X 714 P PP G PPPP PP PP G PP P PPP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLP-----PPPPGMRPMPPQPPFMPPPPRMQ 1276 Query: 715 XPXXXXPPXXPPP 753 P PP P P Sbjct: 1277 PPGPPGPPGPPGP 1289 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGX 673 PP G P P PP G PPPP P P PP G Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGP 1283 Query: 674 PXPP 685 P PP Sbjct: 1284 PGPP 1287 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXX--PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PPP G P PPPPP G P PP PP P G PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPP----GMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +1 Query: 538 PPP--PPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPP 690 PPP PP G PPPP P R P G PP P Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PPP G P PPPPP GG PPPP PPP P GG PPPP Sbjct: 292 PPPPPADGSAPAP---PPPPPPGG------APPPPPPPPPP---PPGDGGAPPPPPP 336 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 PPPPP G PPP PPP GG PPPP P PP G PPP Sbjct: 292 PPPPPADGSAPA----PPPPPPP---------GGAPPPPPP---PPPPPPGDGGAPPP 333 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 593 PXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P PPP P PPPP G PP PPP PP PPPP Sbjct: 290 PVPPPPPADG----SAPAPPPPPPPGGAPPPPPP--PPPPPPGDGGAPPPPPPP 337 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPP 604 PPP GG P PPPPP G PPPP PP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGA-----PPPPPPP 337 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 635 GGVXXPPPP--XGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 GG PPPP G P PP PPP PP PPPP G Sbjct: 287 GGAPVPPPPPADGSAPAPPP----PPPPGGAPPPPPPPPPPPPGDG 328 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 635 GGVXXPPPPXGGX---PXPPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 G PPPP G P PP G PPP PP PPPP G Sbjct: 288 GAPVPPPPPADGSAPAPPPPPPPGGAPPPPP-----PPPPPPPGDGG 329 Score = 34.7 bits (76), Expect(2) = 0.007 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +1 Query: 664 GGXXXPPPPXXG----APPPXXPXXXXPPXXPPP 753 GG PPPP APPP P PP PPP Sbjct: 287 GGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +1 Query: 664 GGXXXPPPPXXGA----PPPXXPXXXXPPXXPPPXXXXG 768 G PPPP G+ PPP P PP PPP G Sbjct: 288 GAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPG 326 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 PPPP GAPPP PP PPP G Sbjct: 306 PPPPPGGAPPPP------PPPPPPPPGDGG 329 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEX 459 P P + G A P P PPPP GG P P G GG Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPP------PPPPPPPPPGDGGAP 331 Query: 460 XPPP 471 PPP Sbjct: 332 PPPP 335 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 411 GXXPGXXXPPGGGGGXXPXPXPLXFFXPPPGXGG 512 G P PP GG P P P PPPG GG Sbjct: 299 GSAPAPPPPPPPGGAPPPPPPPP---PPPPGDGG 329 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 274 SXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGG 384 S P P P G A PP PPPPPP GG Sbjct: 300 SAPAPPPPPPPGGAPPP-------PPPPPPPPPGDGG 329 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 PPP P G PPPPPGG P P Sbjct: 292 PPPPPADGS------APAPPPPPPPGGAPPPPPPP 320 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 AGXPXPLPXXXPPXPPXPSXPP 906 A P P P PP PP P PP Sbjct: 303 APPPPPPPGGAPPPPPPPPPPP 324 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 PPP PGG PPPPPG P P Sbjct: 306 PPPPPGGAPPPPP-----PPPPPPPGDGGAPPPPP 335 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP PPPP P PP Sbjct: 307 PPPPGGAPPPPPPPPPPPP 325 Score = 23.0 bits (47), Expect(2) = 0.007 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 844 GXPXPLPXXXPPXPPXPSXPP 906 G P P P PP P PP Sbjct: 312 GAPPPPPPPPPPPPGDGGAPP 332 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 46.0 bits (104), Expect = 4e-05 Identities = 29/96 (30%), Positives = 30/96 (31%) Frame = +1 Query: 466 PPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXR 645 PP + PP G G PPP PPPP P G Sbjct: 2115 PPSMGRYNTPPPMGQYGAPARPAMGPPPMGSSRYG----PPPPMGPARHSPSGPSPLGAP 2170 Query: 646 XXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 PP G PP GAPP P PP PP Sbjct: 2171 PSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP 2206 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = +1 Query: 541 PPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXP 720 PPPP G P P PP G PP G PP G PP P Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPM----GAPPSGPPPMGAPPSGPPPMGTPPSGHP 2205 Query: 721 XXXXPPXXPPP 753 PP PPP Sbjct: 2206 PMGAPPMGPPP 2216 Score = 30.3 bits (65), Expect = 2.4 Identities = 28/107 (26%), Positives = 31/107 (28%), Gaps = 5/107 (4%) Frame = +1 Query: 253 KERSPNXSXPPXPXPLXX-GAAXPPVTRRXPFXXPP--PPPPXXXGGXXXXXXXXXGAXP 423 +E P+ P P+ GA P P PPPP GA P Sbjct: 2112 EEGPPSMGRYNTPPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPP 2171 Query: 424 GXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPP--PPPXG 558 P G PP PP G PP PPP G Sbjct: 2172 SVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSG 2218 Score = 30.3 bits (65), Expect = 2.4 Identities = 27/92 (29%), Positives = 28/92 (30%), Gaps = 7/92 (7%) Frame = +2 Query: 458 GXXPXXXXXFXPPPXXGGGXXGX----PXXXPP--PPPXGGXGXXXXXPPPPXPPPXPXX 619 G P + PPP G P PP PPP G PP PP P Sbjct: 2139 GPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAP--PSGPPPMGAPPSGPPP 2196 Query: 620 XXXXXGGVXXPPPPXGGXP-XPPXXXXGXPPP 712 G PP G P PP P P Sbjct: 2197 MGTPPSG----HPPMGAPPMGPPPSGSHSPAP 2224 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/81 (24%), Positives = 21/81 (25%) Frame = -2 Query: 675 GXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXG 496 G PP G PP G G P G G P PP G Sbjct: 2139 GPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMG 2198 Query: 495 GGKKXKXXXGXXPFPPXPXGA 433 G P P P G+ Sbjct: 2199 TPPSGHPPMGAPPMGPPPSGS 2219 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 PPPPP PPPP P PPPP P PP PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +2 Query: 584 PPPPXPP-PXPXXXXXXXGGVXXPPPPXG--GXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 PPPP PP P PPPP P PP PPP PP PP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +2 Query: 590 PPXPPPXPXXXXXXXGGVXXPPPPXGGX--PXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP PPP P PPPP P PP PPP PP P P Sbjct: 50 PPPPPPSPPA-----AAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPP 366 P SP + P P P A PP P PPPPP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 PP P P A PP P PPP P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAP 81 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 PPPP PPP P GG PPPP G P PP G P Sbjct: 195 PPPPPPPPPPGFP----GGAPPPPPPPFGAPPPPALNGGPP 231 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 521 GXPXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 G P PPPPP G G PPPP P P Sbjct: 193 GMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 33.5 bits (73), Expect = 0.25 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 583 PPPPXPPPXXXXXXXXXXGXRXXXPPX--GGXXXPPPPXXGAPPP 711 PPPP PPP PP GG PPPP GAPPP Sbjct: 195 PPPPPPPP----------------PPGFPGGAPPPPPPPFGAPPP 223 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 638 GVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXP 745 G+ PPPP P PP G PPP PP P Sbjct: 193 GMPPPPPP----PPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 31.9 bits (69), Expect(2) = 0.093 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 658 PXGGXXXPPPPXXGAPPPXXPXXXXPPXXPP 750 P G PPPP PPP P PP PP Sbjct: 190 PMAGMPPPPPP---PPPPGFPGGAPPPPPPP 217 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 420 PGXXXPPGGGGGXXPXPXPLXFFXPPPGXGGG 515 P PPG GG P P P PPP GG Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPPPPALNGG 229 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P G P PP PPP PP PPPP Sbjct: 188 PSPMAGMPPPPP-----PPPPPGFPGGAPPPPPPP 217 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPP 363 PP P P G A PP PF PPPP Sbjct: 199 PPPPPPGFPGGAPPPPP--PPFGAPPPP 224 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPP 595 PPP G G P PPPPP G PPPP Sbjct: 199 PPPPPPGFPGGAPP--PPPPPFGA-------PPPP 224 Score = 21.8 bits (44), Expect(2) = 0.093 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 841 AGXPXPLPXXXPPXPPXPSXPP 906 A P P P PP P PP Sbjct: 210 APPPPPPPFGAPPPPALNGGPP 231 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPPP PPP G PPPP PP PP PP PPPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPP-------PPPEPTSELPPPPPPP 329 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +2 Query: 548 PPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXX 727 PP PPPP PPP G PPPP PP PPP Sbjct: 269 PPIPSASQNATPPPPP-PPPSNTPGMFASSGFQPPPPPPTDFAPPP------PPPEPTSE 321 Query: 728 XXPPXPPP 751 PP PPP Sbjct: 322 LPPPPPPP 329 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 4/45 (8%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPP----PXPPPXP 613 PPP G PPPPP P P P PPP P Sbjct: 285 PPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 6/62 (9%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPPPX--GGXGXXXXXPPPPXP----PPXPXXXXXXXGGVXXPP 655 PP P PPPP G PPPP P PP P + PP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPP--PPEPTSELPPPP 326 Query: 656 PP 661 PP Sbjct: 327 PP 328 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/123 (23%), Positives = 30/123 (24%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 PP P PP P P P + P PP P PP PP Sbjct: 206 PPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPAS 265 Query: 719 XXXXXPPXPPPPXXRGXXXXXXXXXXXXXXXXXXXXXXXXXXGXPXPSXXXXPPXPXPPX 898 PP PP P P P PP P P Sbjct: 266 PNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPT 325 Query: 899 XPP 907 PP Sbjct: 326 APP 328 Score = 37.1 bits (82), Expect = 0.021 Identities = 43/178 (24%), Positives = 46/178 (25%), Gaps = 9/178 (5%) Frame = +1 Query: 241 TAPQKERSPNXSXPPXPX----PLXXGAAXPPVTRRXPFXXPPPPPPXXX---GGXXXXX 399 T P P + PP P PL G+ P P P PP P Sbjct: 190 TPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPE 249 Query: 400 XXXXGAXPGXXXPXGXGGEXXPP-PXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXX 576 A P P PP P PP PP PP Sbjct: 250 TPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPN---LFIP 306 Query: 577 XXPPPPXPPPXXXXXXXXXXGXRXXXPPXG-GXXXPPPPXXGAPPPXXPXXXXPPXXP 747 PP P PP PP PP P + PP P PP P Sbjct: 307 SAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 35.5 bits (78), Expect = 0.063 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 P PP PP P PP PP P P PP P PP G P Sbjct: 172 PETKPPKPP--APSTIPTPPTPPAPPSPPIP-------TAPPTPPMPETPLPP----GSP 218 Query: 707 --PPXXXXXXXPPXPPPP 754 PP PP PP P Sbjct: 219 HIPPAPLHPHIPPAPPNP 236 Score = 35.1 bits (77), Expect = 0.083 Identities = 33/128 (25%), Positives = 34/128 (26%), Gaps = 5/128 (3%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPP--PXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPP- 708 PP PP PP P P P PP PP P APP Sbjct: 230 PPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPA-----PPNPSIPAPPN 284 Query: 709 PXXPXXXXPPXXPP--PXXXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXPLPXXXPPX 882 P P P PP P + P P PP Sbjct: 285 PSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPA 344 Query: 883 PPXPSXPP 906 PP PS PP Sbjct: 345 PPNPSIPP 352 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXG--GXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGX 580 GGG GG GGG G G G GGGG T G G GGGG Sbjct: 250 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 309 Query: 579 XXXXPXPPXGGGGGXXXG 526 GGGG G Sbjct: 310 TGVGGGATGGGGGATGGG 327 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXG--GXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGX 580 GGG GG GGG G G G GGGG T G G GGGG Sbjct: 264 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGA 323 Query: 579 XXXXPXPPXGGGGGXXXG 526 GGGG G Sbjct: 324 TGGGVGATGGGGGATGGG 341 Score = 42.7 bits (96), Expect = 4e-04 Identities = 28/75 (37%), Positives = 28/75 (37%) Frame = -2 Query: 762 RXXGGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 R GGG GG GGG GG G GGGG G GG GGGG Sbjct: 240 RLGGGGATGGGGGATGGGGGAT----GGGGGATGGGGG--ATGGGGGATGGGGGATGGGG 293 Query: 582 XXXXXPXPPXGGGGG 538 GGGGG Sbjct: 294 GATGGGGGATGGGGG 308 Score = 42.3 bits (95), Expect = 5e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXG--GXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGX 580 GGG GG GGG G G G GGGG T G G GGGG Sbjct: 285 GGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGV 344 Query: 579 XXXXPXPPXGGGGGXXXG 526 GGGG G Sbjct: 345 TGGGGGATGGGGGPGSGG 362 Score = 41.9 bits (94), Expect = 7e-04 Identities = 43/164 (26%), Positives = 44/164 (26%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXX 573 GG G GGG GGGG G GG GGGG Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGG------------GGGATGGGGGAT 275 Query: 572 XXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXAPXXXXXX 393 GGGGG G GGG + G G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGAT------GGGGGATGVGGGATGGGGGATGGGVG 329 Query: 392 XXFPPXXXGGGGGGXXKGXRRVTGGXAAPXXRGXGXGGXEXXGL 261 GGGGG G TGG P G G G E L Sbjct: 330 ATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDGTENVSL 373 Score = 40.7 bits (91), Expect = 0.002 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 2/89 (2%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXG--GXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGX 580 GGG GG GGG G G G GGGG T G GGG GGG Sbjct: 271 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT--GVGGGATGGGGGATGGGV 328 Query: 579 XXXXPXPPXGGGGGXXXGXPXXPPPXXGG 493 GGGG G GG Sbjct: 329 GATGGGGGATGGGGGVTGGGGGATGGGGG 357 Score = 37.9 bits (84), Expect = 0.012 Identities = 36/126 (28%), Positives = 36/126 (28%), Gaps = 3/126 (2%) Frame = -2 Query: 906 GGXXGGXGXGGXXXXEGXGXPXXXXXXXXXXXXXXXXXXXXXXXXXXPRXXGGGGXGGXX 727 GG G G GG G G GGG GG Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Query: 726 XXXXXGGGXPXXXXG--GXGXPPXGGGGXXTPPXXXXXXXGXGGG-XGGGGXXXXXPXPP 556 GGG G G G GGGG T G GGG GGGG P Sbjct: 308 GATGVGGGATGGGGGATGGGVGATGGGGGAT---------GGGGGVTGGGGGATGGGGGP 358 Query: 555 XGGGGG 538 GG G Sbjct: 359 GSGGCG 364 Score = 32.3 bits (70), Expect = 0.59 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 684 GGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 GG G GGGG T G GG GGGG GGGGG G Sbjct: 242 GGGGAT--GGGGGATG-GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 291 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/87 (34%), Positives = 31/87 (35%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PP G G P PPPP PPP P P G+ PPP G Sbjct: 224 PPMIPPVGMLGHPPMGAPPPP---HSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPP--G 278 Query: 671 XPXPPXXXXGXPPPXXXXXXXPPXPPP 751 P PP G PP PP PPP Sbjct: 279 MP-PPMPPGGMPP----NMEQPPPPPP 300 Score = 35.5 bits (78), Expect = 0.063 Identities = 38/144 (26%), Positives = 38/144 (26%), Gaps = 7/144 (4%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTR--RXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGG 453 PP PPV P PPPP G P P G GG Sbjct: 215 PPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMP-GMGG 273 Query: 454 EXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXX 633 PPP PP GG PPPPP PP P Sbjct: 274 --MPPPGM-----PPPMPPGGMPPNMEQPPPPPPSSGVSNSGMMPPHMQNPQHMGHQMMP 326 Query: 634 XGXRXXXPP-----XGGXXXPPPP 690 PP G PPPP Sbjct: 327 GMMPQQFPPNLMWGMTGQTRPPPP 350 Score = 33.5 bits (73), Expect = 0.25 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPP 589 P G G G P PPP GG PPPPP G PP Sbjct: 265 PMGMPGMGGMPPPGM---PPPMPPGGMPPNMEQPPPPPPSSGVSNSGMMPP 312 Score = 31.9 bits (69), Expect = 0.77 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 4/63 (6%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXX--PPP--PPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPP 658 PPP G P PPP PP G G PP PP P PPP Sbjct: 241 PPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPP 300 Query: 659 PXG 667 G Sbjct: 301 SSG 303 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 PP G PPPP PP P PP PP G Sbjct: 236 PPMGA---PPPPHSMPPPGMPPPGMMPPPGFPPMGMPG 270 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = -3 Query: 602 GGXGGGGXXXXXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXP 423 G G GG PP GG PPPPP G +P P Sbjct: 267 GMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPSSGVSNSGMMPPHMQNPQHMGHQMMP 326 Query: 422 GXAP 411 G P Sbjct: 327 GMMP 330 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 42.3 bits (95), Expect = 5e-04 Identities = 27/89 (30%), Positives = 28/89 (31%), Gaps = 1/89 (1%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPP-PPXG 667 PPP G G P P P G G P PP PP G + P P Sbjct: 39 PPPPGPPGPDGPPGFPGPQGPNGPKGPPGL-PGPPGPPGFQGPPGNPAGAIGPPGLPGPN 97 Query: 668 GXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 G PP PP P PP P Sbjct: 98 GVNGPPGELGDMGPPGPPGPPGPQMPPGP 126 Score = 40.7 bits (91), Expect = 0.002 Identities = 36/127 (28%), Positives = 38/127 (29%), Gaps = 4/127 (3%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPP-PXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPX 714 PPPPP PPPP PP P G P G P PP PP Sbjct: 29 PPPPPP-----YEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGN 83 Query: 715 XPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXP-LPXXXP--PXP 885 PP P P G G P P +P P P P Sbjct: 84 PAGAIGPPGLPGPNGVNG-----------PPGELGDMGPPGPPGPPGPQMPPGPPGLPGP 132 Query: 886 PXPSXPP 906 P P+ PP Sbjct: 133 PGPAGPP 139 Score = 40.7 bits (91), Expect = 0.002 Identities = 44/175 (25%), Positives = 45/175 (25%), Gaps = 6/175 (3%) Frame = +1 Query: 247 PQKERSPNXSXPPXPX-PLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXP 423 P E P PP P P P + P P PP P G G P Sbjct: 33 PPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGP-P 91 Query: 424 GXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPP-----PPPXGGXXXXXXXPP 588 G P G G PP PP G PP P P G P Sbjct: 92 GLPGPNGVNG----PPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGP 147 Query: 589 PPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 P P G G P P PP P PP P P Sbjct: 148 PGDVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGP 202 Score = 39.5 bits (88), Expect = 0.004 Identities = 43/188 (22%), Positives = 44/188 (23%), Gaps = 4/188 (2%) Frame = +1 Query: 355 PPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXX 534 PP PP G PG P G GE PP PP GG Sbjct: 111 PPGPPGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDV----GPPGNPGGPGLQGNH 166 Query: 535 XPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPX 714 P G P P P G + P G P P PP Sbjct: 167 GNPAGIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGT 226 Query: 715 XPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXXXXA-GXPXPLPXXXPPX--- 882 P PP G G P P PP Sbjct: 227 NGPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPG 286 Query: 883 PPXPSXPP 906 PP P PP Sbjct: 287 PPGPQMPP 294 Score = 39.5 bits (88), Expect = 0.004 Identities = 51/214 (23%), Positives = 53/214 (24%), Gaps = 10/214 (4%) Frame = +2 Query: 296 PXXGGPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXGXGGXGXXPXX 475 P GPP P G P + G P A P G G G Sbjct: 452 PGLPGPPGPQMPPGPPGL------PGAPGPNGPPGINGPLGPPGEAGPPGNPG-GPGYQG 504 Query: 476 XXXFXPPPXXGGGXXGXPXXXPPPPPXGGXG-XXXXXPPPPXPPPXPXXXXXXXG----- 637 P G G P PP P G G PP P PP P G Sbjct: 505 NHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 564 Query: 638 GVXXP--PPPXGGXPXPP--XXXXGXPPPXXXXXXXPPXPPPPXXRGXXXXXXXXXXXXX 805 G+ P PP G P P G P PP G Sbjct: 565 GINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGL 624 Query: 806 XXXXXXXXXXXXXGXPXPSXXXXPPXPXPPXXPP 907 G P P PP P P PP Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 38.7 bits (86), Expect = 0.007 Identities = 56/220 (25%), Positives = 56/220 (25%), Gaps = 12/220 (5%) Frame = +1 Query: 283 PXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXX 462 P P G PP P PP P G PG P G G Sbjct: 175 PNGLPGPNGPLGPP---GPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLG 231 Query: 463 PPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXG--GXXXXXXXPPPPXPPPXXXXXXXXXX 636 PP PP GG P P G G PP PP Sbjct: 232 PPGDV----GPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPP--------GDM 279 Query: 637 GXRXXXPPXGGXXXPPPPXX-GAPPPXXPXXXXPPXXPP----PXXXXGXXXXXXXXXXX 801 G P G P PP GAP P P P PP P G Sbjct: 280 GPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNP 339 Query: 802 XXXXXXXXXXXXXA--GXPXPLPXXXP---PXPPXPSXPP 906 G P PL P P PP P PP Sbjct: 340 AGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPP 379 Score = 38.3 bits (85), Expect = 0.009 Identities = 56/225 (24%), Positives = 57/225 (25%), Gaps = 10/225 (4%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPX 441 +P P P G PP P PP P G PG P Sbjct: 253 NPAGPQGPNGLPGPNGILGPP---GPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 309 Query: 442 GXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXX 621 G G PP PP GG P P G PP PP Sbjct: 310 GTNGPLGPPGDV----GPPGNPGGPGYQGNHGNPAGPQG--PNGQPGPPGINGPPGPLGD 363 Query: 622 XXXXXGXRXXXPPXGGXXXPPPPXX-GAPPPXXPXXXXPPXXPP----PXXXXGXXXXXX 786 G P G P PP GAP P P P PP P G Sbjct: 364 V----GPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGYQG 419 Query: 787 XXXXXXXXXXXXXXXXXXA--GXPXPLPXXXP---PXPPXPSXPP 906 G P PL P P PP P PP Sbjct: 420 NHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPP 464 Score = 36.3 bits (80), Expect = 0.036 Identities = 44/165 (26%), Positives = 44/165 (26%), Gaps = 12/165 (7%) Frame = +2 Query: 290 PXPXXGGPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXG--XGGXG- 460 P P PPPPP G G P P G G G Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGP 90 Query: 461 -XXPXXXXXFXPPPXXGG-GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXX 634 P PP G G G P P P G G PP P PP Sbjct: 91 PGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPG--LPGPPGPAGPPGTNGELGPP 148 Query: 635 GGVXXPPPPXG-------GXPXPPXXXXGXPPPXXXXXXXPPXPP 748 G V P P G G P G P P PP PP Sbjct: 149 GDVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGP--NGPLGPPGPP 191 Score = 35.5 bits (78), Expect = 0.063 Identities = 36/146 (24%), Positives = 39/146 (26%) Frame = +2 Query: 311 PPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXGXGGXGXXPXXXXXFX 490 PPPPP + P G P+ P G G P F Sbjct: 29 PPPPPPYEAPPP---------PPGPPGPDGPPGFPGPQGPNGPKGPPGL-PGPPGPPGFQ 78 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PP G G P P G G PP P P G+ PP P G Sbjct: 79 GPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAG- 137 Query: 671 XPXPPXXXXGXPPPXXXXXXXPPXPP 748 PP PP P P Sbjct: 138 ---PPGTNGELGPPGDVGPPGNPGGP 160 Score = 35.1 bits (77), Expect = 0.083 Identities = 27/106 (25%), Positives = 28/106 (26%), Gaps = 1/106 (0%) Frame = +1 Query: 454 EXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXX 633 E PPP + PP G G P P G P PP PP Sbjct: 27 ETPPPPPPYE-APPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPA 85 Query: 634 XG-XRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 P G PP PP P P P P G Sbjct: 86 GAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPG 131 Score = 34.7 bits (76), Expect = 0.11 Identities = 49/208 (23%), Positives = 49/208 (23%), Gaps = 4/208 (1%) Frame = +2 Query: 296 PXXGGPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXGXGGXGXXPXX 475 P GPP PP G P G P G G P Sbjct: 634 PSPPGPPGPPGPKGPPGPNGPLGPPGESGPAGNAGGVGYQGNHGN--PAGVQGPNGQPGP 691 Query: 476 XXXFXPPPXXGG----GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGV 643 PP G G G P PP P G G PP P PP P G Sbjct: 692 PGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPG-----PPGPNGPPGPNGPLGPPGEC 746 Query: 644 XXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRGXXXXXXXXXXXXXXXXXXX 823 P GG G P P PP G Sbjct: 747 G-PAGNAGGVGCQ--GHHGNPAGSQGPNGQPG---PPGINGPPGQVGEMGPPGLPGPPGP 800 Query: 824 XXXXXXXGXPXPSXXXXPPXPXPPXXPP 907 G P P PP P P PP Sbjct: 801 ASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 34.3 bits (75), Expect = 0.14 Identities = 40/161 (24%), Positives = 40/161 (24%), Gaps = 4/161 (2%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXG----GGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPP 604 P G G P PP G G G P PP P G G PP P P Sbjct: 594 PAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPG-----PPGPKGP 648 Query: 605 PXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRGXXXXXX 784 P P G P GG G P P PP G Sbjct: 649 PGPNGPLGPPGE-SGPAGNAGGVGYQ--GNHGNPAGVQGPNGQPG---PPGINGPPGQIG 702 Query: 785 XXXXXXXXXXXXXXXXXXXXGXPXPSXXXXPPXPXPPXXPP 907 G P P PP P P PP Sbjct: 703 EMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 33.5 bits (73), Expect = 0.25 Identities = 47/186 (25%), Positives = 48/186 (25%), Gaps = 18/186 (9%) Frame = +1 Query: 265 PNXSXPPXPX--PLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXP 438 P PP P P G A PP T PP GG G G P Sbjct: 118 PGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGPGLQGNH--GNPAGIQGP 175 Query: 439 XGXGGEXXP--PPXXFXFFXPPXGGGGGXXXXXXXPP----------PPPXGGXXXXXXX 582 G G P PP PP G PP PP G Sbjct: 176 NGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGD 235 Query: 583 PPPPXPP--PXXXXXXXXXXGXRXXX--PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPP 750 PP P P G + P G PP P PP P P P Sbjct: 236 VGPPGNPGGPGYQGNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPPG 295 Query: 751 PXXXXG 768 P G Sbjct: 296 PPGLPG 301 Score = 33.5 bits (73), Expect = 0.25 Identities = 38/149 (25%), Positives = 39/149 (26%), Gaps = 1/149 (0%) Frame = +2 Query: 308 GPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXGXGGXGXX-PXXXXX 484 G P PP +G P G P AP G G P Sbjct: 347 GQPGPPGINGPPGPLGDVGPPGLPG--PPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPG 404 Query: 485 FXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPX 664 PP GG P P G G PP PP P G P PP Sbjct: 405 DVGPPGNPGGPGYQGNHGNPAGPQGPNG--QPGPPGINGPPGPLGDVGPPG---LPGPPG 459 Query: 665 GGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 P P G P P P PP Sbjct: 460 PQMPPGPPGLPGAPGPNGPPGINGPLGPP 488 Score = 33.1 bits (72), Expect = 0.33 Identities = 34/140 (24%), Positives = 34/140 (24%), Gaps = 3/140 (2%) Frame = +2 Query: 296 PXXGGPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXGXGGXGXXPXX 475 P G PP G P G P G G P Sbjct: 273 PGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGPGY 332 Query: 476 XXXFXPP--PXXGGGXXGXPXXXPPPPPXGGXG-XXXXXPPPPXPPPXPXXXXXXXGGVX 646 P P G G P PP P G G PP P PP P G Sbjct: 333 QGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGP---PGLPGAPG 389 Query: 647 XPPPPXGGXPXPPXXXXGXP 706 PP P P G P Sbjct: 390 PKGPPGTNGPLGPPGDVGPP 409 Score = 32.7 bits (71), Expect = 0.44 Identities = 35/150 (23%), Positives = 36/150 (24%), Gaps = 2/150 (1%) Frame = +2 Query: 308 GPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRXXAAPXGXGGXGXXPXXXXXF 487 GP P G P V G P P G G P Sbjct: 596 GPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPL 655 Query: 488 XPPPXXG--GGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PP G G G P G G PP P G+ PP P Sbjct: 656 GPPGESGPAGNAGGVGYQGNHGNPAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGP 715 Query: 662 XGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 P P G P P P PP Sbjct: 716 AS--PPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 31.9 bits (69), Expect = 0.77 Identities = 49/187 (26%), Positives = 51/187 (27%), Gaps = 19/187 (10%) Frame = +1 Query: 265 PNXSXPPXPX--PLXXGAAXPPVTRRXPFXXP----PPPPPXXXG-----GXXXXXXXXX 411 P PP P P G PP T P P PP P G G Sbjct: 288 PGPQMPPGPPGLPGAPGPKGPPGTN-GPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPN 346 Query: 412 G--AXPGXXXPXGXGGEXXPP--PXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXX 579 G PG P G G+ PP P PP G G PP G Sbjct: 347 GQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPP--GPPGLPGAPGPKGPPGTNGPLGPPG 404 Query: 580 XPPPPXPP--PXXXXXXXXXXGXRXXXPPXG--GXXXPPPPXXGAPPPXXPXXXXPPXXP 747 PP P P G + G G PP P PP P P P Sbjct: 405 DVGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPP 464 Query: 748 PPXXXXG 768 P G Sbjct: 465 GPPGLPG 471 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 1/80 (1%) Frame = +2 Query: 512 GXXGXPXXXPPPPPXGGXGXXXXXPPP-PXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPX 688 G G P PP G G PP P PP P G PP P G P Sbjct: 857 GQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGP-KGPPGPNGCLGPPGD 915 Query: 689 XXXGXPPPXXXXXXXPPXPP 748 PP PP Sbjct: 916 AGPAGNTGGAGCQPAPPCPP 935 Score = 29.5 bits (63), Expect = 4.1 Identities = 47/182 (25%), Positives = 49/182 (26%), Gaps = 19/182 (10%) Frame = +1 Query: 280 PPXPX--PLXXGAAXPPVTRRXPFXXPPPP-PPXXXGGXXXXXXXXXGAXP--------- 423 PP P P G PP T P P PP GG A P Sbjct: 208 PPGPPGLPGAPGPKGPPGTN-GPLGPPGDVGPPGNPGGPGYQGNHGNPAGPQGPNGLPGP 266 Query: 424 -GXXXPXGXGGEXXPP--PXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPP 594 G P G G+ PP P PP G G PP G PP Sbjct: 267 NGILGPPGPPGDMGPPGLPGPPGPQMPP--GPPGLPGAPGPKGPPGTNGPLGPPGDVGPP 324 Query: 595 XPP--PXXXXXXXXXXGXRXXXPPXG--GXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXX 762 P P G + G G PP P PP P P P P Sbjct: 325 GNPGGPGYQGNHGNPAGPQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGL 384 Query: 763 XG 768 G Sbjct: 385 PG 386 Score = 29.5 bits (63), Expect = 4.1 Identities = 48/211 (22%), Positives = 48/211 (22%), Gaps = 3/211 (1%) Frame = +1 Query: 283 PXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXX 462 P P G PP P P PP G PG G G Sbjct: 451 PPGLPGPPGPQMPPGPPGLPGAPGPNGPPGING---PLGPPGEAGPPGNPGGPGYQGNHG 507 Query: 463 PPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXG--GXXXXXXXPPPPXPP-PXXXXXXXXX 633 P P G G PP P G G P P PP P Sbjct: 508 NPAG-------PQGPNGQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAPGP 560 Query: 634 XGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXX 813 G P G PP P P P G Sbjct: 561 NGPPGINGPLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPG--------PPGVNGP 612 Query: 814 XXXXXXXXXAGXPXPLPXXXPPXPPXPSXPP 906 AG P P PP PP P PP Sbjct: 613 PGEIGEIGPAGLPGPPGPASPPSPPGPPGPP 643 Score = 28.3 bits (60), Expect = 9.5 Identities = 42/171 (24%), Positives = 43/171 (25%), Gaps = 2/171 (1%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXGAAXPP--VTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXX 435 +P S P P G PP V P P PP P PG Sbjct: 763 NPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPP-----GPPGPKG 817 Query: 436 PXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXX 615 P G G PP P G GG P G P PP Sbjct: 818 PPGPNGPLGPPGEC-----GPAGNAGGVGCQGNHGNPAGSQGPNGQPGPPGINGPPGQVG 872 Query: 616 XXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 PP G PP P PP P P P P G Sbjct: 873 EMG----------PP--GLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLG 911 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 41.9 bits (94), Expect = 7e-04 Identities = 43/162 (26%), Positives = 45/162 (27%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXG 444 P S P P + PP + P PPPP P G P P Sbjct: 310 PAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPV- 368 Query: 445 XGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXX 624 PP PP G G PPPP PPPP PP Sbjct: 369 ----QRPPG-----MRPPGAGNG------PGGPPPPWSKPGGILPGPPPPGPP------- 406 Query: 625 XXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPP 750 PP PP PPP P PP PP Sbjct: 407 --MLNMAPSIPPWQTTPGYIPP----PPPGFPQFQPPPPPPP 442 Score = 37.5 bits (83), Expect = 0.016 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 3/76 (3%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPP---PXPXXXXXXXGGVXXPPPPX 664 PP G G G PPPP G PPPP PP P PPPP Sbjct: 376 PPGAGNGPGG------PPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPP 429 Query: 665 GGXPXPPXXXXGXPPP 712 G P PPP Sbjct: 430 G---FPQFQPPPPPPP 442 Score = 32.7 bits (71), Expect = 0.44 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 9/97 (9%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPP---PPPXGGXGXXXXXPPPPX----PPPXPXXXXXXXGGVXX 649 PPP PP PPP PP P PPP + Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMST 366 Query: 650 PP--PPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P PP P G PPP P PPPP Sbjct: 367 PVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPP 403 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/75 (36%), Positives = 27/75 (36%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXX 571 GG GG GGG G G GGGG T G GG GGGG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGAT--------GGHGGATGGGGGATG 91 Query: 570 XPXPPXGGGGGXXXG 526 GGGGG G Sbjct: 92 DGGGATGGGGGATGG 106 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/76 (35%), Positives = 27/76 (35%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGG GG GGG GG G GGGG G GG GGGG Sbjct: 58 GGGATGGGGGATGGGGGAT----GGHGGATGGGGG--ATGDGGGATGGGGGATGGGGGAT 111 Query: 573 XXPXPPXGGGGGXXXG 526 GGG G G Sbjct: 112 GGHGGATGGGVGATGG 127 Score = 39.1 bits (87), Expect = 0.005 Identities = 26/78 (33%), Positives = 26/78 (33%), Gaps = 2/78 (2%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXG--GGGXXTPPXXXXXXXGXGGGXGGGGX 580 GGGG G GGG GG G GGG G GG GG G Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGG 144 Query: 579 XXXXPXPPXGGGGGXXXG 526 GGGGG G Sbjct: 145 ATGGGGGATGGGGGATGG 162 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 1/77 (1%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGG-XGGGGXX 577 GGG GG GGG G G GG G GG GGGG Sbjct: 93 GGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGA 152 Query: 576 XXXPXPPXGGGGGXXXG 526 GGGGG G Sbjct: 153 TGGGGGATGGGGGATGG 169 Score = 37.1 bits (82), Expect = 0.021 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 8/84 (9%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXG--GXGXPPXGGGGXXT------PPXXXXXXXGXGGG 598 GGG GG GGG G G G GGGG T G GG Sbjct: 72 GGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGA 131 Query: 597 XGGGGXXXXXPXPPXGGGGGXXXG 526 GG G GGGGG G Sbjct: 132 TGGHGGATGGHGGATGGGGGATGG 155 Score = 32.7 bits (71), Expect = 0.44 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXX 571 GGG G GG GG G GGG G GG GG Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGV 122 Query: 570 XPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GG G G GGG Sbjct: 123 GATGGHGGATGGHGGATGGHGGATGGG 149 Score = 29.1 bits (62), Expect = 5.5 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 G GG G GGG G G GGGG T G GG GG G Sbjct: 38 GHGGATGGHGGATGGGG------GATGGGATGGGGGAT--------GGGGGATGGHGGAT 83 Query: 573 XXPXPPXGGGGGXXXG 526 G GGG G Sbjct: 84 GGGGGATGDGGGATGG 99 Score = 29.1 bits (62), Expect = 5.5 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -2 Query: 747 GGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXX 568 GG GG GGG GG G G GG G G GGG Sbjct: 51 GGGGGATGGGATGGGG--GATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGA----- 103 Query: 567 PXPPXGGGGGXXXG 526 GGGGG G Sbjct: 104 ----TGGGGGATGG 113 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/80 (36%), Positives = 29/80 (36%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 P PP P G PP PP P G PPPP G P P G P Sbjct: 431 PQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRG---MPPPPMGMYPPP----RGFP 483 Query: 707 PPXXXXXXXPPXPPPPXXRG 766 PP P PPPP RG Sbjct: 484 PP-------PFGPPPPFYRG 496 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXX 717 PPPP G PP P PP PP GG PPP G PP Sbjct: 428 PPPPQHTG-------PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPR 480 Query: 718 PXXXXPPXXPPPXXXXG 768 PP PPP G Sbjct: 481 -GFPPPPFGPPPPFYRG 496 Score = 39.5 bits (88), Expect = 0.004 Identities = 34/102 (33%), Positives = 34/102 (33%), Gaps = 4/102 (3%) Frame = +2 Query: 419 PRXXAAPXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPP----PPPXGGXGXXXXXP 586 P P G G P PPP GG G P PP PPP G P Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPP---GGMRGMPP--PPMGMYPPPRG-------FP 483 Query: 587 PPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 PPP PP P PPPP G P P PP Sbjct: 484 PPPFGPPPPF--------YRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 37.9 bits (84), Expect = 0.012 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 6/78 (7%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXP--PPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPP----PPXXG 699 P P P G P PP PPP G R PP G PP PP G Sbjct: 437 PQPRPPHGMPQGGGPPQLPPNLPPPPG--------GMRGMPPPPMGMYPPPRGFPPPPFG 488 Query: 700 APPPXXPXXXXPPXXPPP 753 PPP P PPP Sbjct: 489 PPPPFYRGPPPPRGMPPP 506 Score = 36.7 bits (81), Expect = 0.027 Identities = 33/93 (35%), Positives = 33/93 (35%), Gaps = 5/93 (5%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPP--PPPXGGXGXXXXXPPPPX---PPPXPXXXXXXXGGVXXPP 655 P P G G P PP PPP GG PPPP PPP PP Sbjct: 439 PRPPHGMPQGGGPPQLPPNLPPPPGGM---RGMPPPPMGMYPPPR-----------GFPP 484 Query: 656 PPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP G PP G PPP PP P Sbjct: 485 PPFG---PPPPFYRGPPPPRG--MPPPPRQRMP 512 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPPP P P G P P PPPP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPP 462 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = -2 Query: 567 PXPPXG--GGGGXXXGXPXXPPPXXGGGKKXKXXXGXXP----FPPXPXG 436 P PP G GGG P PPP G G P FPP P G Sbjct: 439 PRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFG 488 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGG GG G G GG G GGGG G GGG GG G Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Query: 573 XXPXPPXGGGGGXXXG 526 G GGG G Sbjct: 211 GGGYGGGGYGGGRSGG 226 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXX 573 GGG GG G GGG GGG GG R GGG GGGG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYR-----GGGGYRGGGGGYRGRGRGGGGYGGGGYGG 178 Query: 572 XXXXPPXGGGGG 537 GGGG Sbjct: 179 GGYGGGGHGGGG 190 Score = 37.5 bits (83), Expect = 0.016 Identities = 29/81 (35%), Positives = 29/81 (35%) Frame = -2 Query: 762 RXXGGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 R GGGG GG GG GG G GGGG G GGG GGGG Sbjct: 164 RGRGGGGYGGGGYGGGGYGGG-GHGGGGYGGGGYGGGGG----GYGGSGYGGGGGYGGGG 218 Query: 582 XXXXXPXPPXGGGGGXXXGXP 520 GGGG P Sbjct: 219 YGGG-----RSGGGGYEVSYP 234 Score = 37.1 bits (82), Expect = 0.021 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 1/76 (1%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXG-GGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGG G GGG GG G G GGG G GG GGGG Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYG 204 Query: 573 XXPXPPXGGGGGXXXG 526 GG GG G Sbjct: 205 GSGYGGGGGYGGGGYG 220 Score = 35.1 bits (77), Expect = 0.083 Identities = 28/87 (32%), Positives = 28/87 (32%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXX 571 GGG G GGG GG GGGG G G G GG G Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGG- 195 Query: 570 XPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GGGGG G GGG Sbjct: 196 -----YGGGGGGYGGSGYGGGGGYGGG 217 Score = 33.9 bits (74), Expect = 0.19 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGGG G GGG GG GGG G GGG GGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYR-----GGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 Query: 573 XXPXPPXGGGGGXXXG 526 G GGG G Sbjct: 178 GGGYGGGGHGGGGYGG 193 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/111 (27%), Positives = 30/111 (27%) Frame = +2 Query: 419 PRXXAAPXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPX 598 P P G GG P P GG P PPP G PPP Sbjct: 157 PPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGG------YAPPPYV 210 Query: 599 PPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 P P PP G PP G PP PP P Sbjct: 211 PQEGGGIPPQNHPLTNYPAPPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYP 261 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/87 (34%), Positives = 31/87 (35%), Gaps = 5/87 (5%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXXPPPP--PXGGXGXXXXXPP-PPXPPPXPXXXXXXXG 637 P + PPP GG P PPP P G G P P P P G Sbjct: 183 PGQPGGYYPPP--GGYQQPPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPPPG 240 Query: 638 GVXXPPPPXGGXP--XPPXXXXGXPPP 712 G PP GG P PP G PPP Sbjct: 241 GYPGA-PPAGGYPGAPPPGGYPGGPPP 266 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 7/77 (9%) Frame = +2 Query: 539 PPPP---PXGGXGXXXXXPPPPX--PPPXPXXXXXXXGGVXXPPPPXGGXPXP--PXXXX 697 PPPP P G G PPP P P G PPP G P P P Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPPPYVPQEGG 215 Query: 698 GXPPPXXXXXXXPPXPP 748 G PP P PP Sbjct: 216 GIPPQNHPLTNYPAPPP 232 Score = 32.7 bits (71), Expect = 0.44 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +1 Query: 544 PPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPP--PPXXGAPPPXX 717 PP GG PP P P G PP GG PP P G PP Sbjct: 163 PPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGG-YQQPPPGGYAPPPYVPQEGGGIPPQN 221 Query: 718 PXXXXPPXXPP 750 P PP Sbjct: 222 HPLTNYPAPPP 232 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 8/95 (8%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPP----PXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXP--- 652 PP GG P PP P P GG G P PPP P P Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYP---PAGGYPPPQPGYAGGPPPPGIAPGIG 79 Query: 653 -PPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPP G PP PP PPPP Sbjct: 80 GPPPSGQYGAPPTSQPYGAPPTSGYPGYQQHPPPP 114 Score = 36.7 bits (81), Expect = 0.027 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 2/86 (2%) Frame = +2 Query: 497 PXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXP 676 P GG P PP P GG P P PP GG P P G P Sbjct: 17 PYMGGYPPAAPGGYPPAP--GGY-----PPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGP 69 Query: 677 XPP--XXXXGXPPPXXXXXXXPPXPP 748 PP G PPP P P Sbjct: 70 PPPGIAPGIGGPPPSGQYGAPPTSQP 95 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 3/90 (3%) Frame = +1 Query: 340 PFXXPPPPP--PXXXGGXXXXXXXXXGAXPGXXXPX-GXGGEXXPPPXXFXFFXPPXGGG 510 P PP P P GG G P G G PP PP G Sbjct: 27 PGGYPPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQ 86 Query: 511 GGXXXXXXXPPPPPXGGXXXXXXXPPPPXP 600 G PP G PPPP P Sbjct: 87 YGAPPTSQPYGAPPTSGYPGYQQHPPPPQP 116 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +3 Query: 588 PPPPPPXXXXXXXXXXGXSXXXPPRGGGXXPPPXXXGGXPPPXXXXXXXPXXPPPXXXXG 767 PP P PP GG P P GG PPP PPP G Sbjct: 31 PPAPGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGI--GGPPPSGQYG 88 Score = 28.3 bits (60), Expect = 9.5 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAP---- 705 PP P G PP P P G PP G PPP AP Sbjct: 23 PPAAPGGYPPAPGGYPPAPGGYPPSGGYGYPPAGG--YPPPQPGYAGGPPPPGIAPGIGG 80 Query: 706 PPXXPXXXXPPXXPP 750 PP PP P Sbjct: 81 PPPSGQYGAPPTSQP 95 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/100 (30%), Positives = 30/100 (30%), Gaps = 3/100 (3%) Frame = +1 Query: 463 PPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGX 642 PPP PP GGG PP PPPP PPP Sbjct: 684 PPPPA----PPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFM 739 Query: 643 RXXXP---PXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 P PPPP PPP P P PPP Sbjct: 740 LTWTPLTNTSSAANVPPPP----PPPAVPGEGARPPPPPP 775 Score = 38.3 bits (85), Expect = 0.009 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 3/91 (3%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPP---PPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PPP GGG PP PP PPPP PPP P + P Sbjct: 690 PPPPIGGGDPTIWVSGGPPLSAPPLSST----LGPPPPAPPPPPLGRDSAAVFMLTWTPL 745 Query: 662 XGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP PP PPPP Sbjct: 746 TNTSSAANVPPPPPPPAVPGEGARPPPPPPP 776 Score = 35.1 bits (77), Expect = 0.083 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 1/81 (1%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 P PPPPP GG P P PPPP G P Sbjct: 685 PPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFMLTWTP 744 Query: 707 -PPXXXXXXXPPXPPPPXXRG 766 PP PPPP G Sbjct: 745 LTNTSSAANVPPPPPPPAVPG 765 Score = 35.1 bits (77), Expect = 0.083 Identities = 26/92 (28%), Positives = 27/92 (29%), Gaps = 7/92 (7%) Frame = +1 Query: 352 PPPPPPXXXGGXXXXXXXXXG---AXPGXXXPXGXGGEXXPPP----XXFXFFXPPXGGG 510 PP PPP GG G + P G PPP F Sbjct: 686 PPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFMLTWTPL 745 Query: 511 GGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPP 606 PPPPP PPPP PPP Sbjct: 746 TNTSSAANVPPPPPPPAVPGEGARPPPPPPPP 777 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 PPPPP PPPP P P P PPPP P P PPP Sbjct: 204 PPPPPP--RPPPSPPPPPPPPSPSPP---------RPPPPPPPSPPRPLAAKLPEPPP-- 250 Query: 719 XXXXXPPXPPPP 754 PP PPP Sbjct: 251 -IPNMPPTLPPP 261 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 641 VXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 + PPPP P PP PPP PP PPPP Sbjct: 201 ITQPPPPP---PRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 36.7 bits (81), Expect = 0.027 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 P PPP P PP P PPP P + PPP P P G Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYL 266 Query: 707 P 709 P Sbjct: 267 P 267 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXR 763 PPPP P PP PPP PP PPP R Sbjct: 205 PPPPPRPPPSPPPPP---PPPSPSPPRPPPPPPPSPPR 239 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 P P PPP P PP PPP P P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +1 Query: 241 TAPQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 T+P + P PP P P PP P PPPPPP Sbjct: 196 TSPSQITQP---PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 PPP P PPPPP P PP P P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 28.3 bits (60), Expect(2) = 0.75 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 674 PXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P PPP PP PPPP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPP 221 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PP P P PP Sbjct: 204 PPPPPPRPPPSPPPPPPPP 222 Score = 22.2 bits (45), Expect(2) = 0.75 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 851 PXPSXXXXPPXPXPPXXPP 907 P P P P PP PP Sbjct: 216 PPPPPPPSPSPPRPPPPPP 234 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPP 607 PPP GGG P PPPPP GG P PP PPP Sbjct: 653 PPPPPGGGMFPPP---PPPPPGGGV------PGPPKPPP 682 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +1 Query: 463 PPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPP 594 PP F PP GGG PPPPP GG PPPP Sbjct: 644 PPNPFFGGIPPPPPGGG----MFPPPPPPPPGGGVPGPPKPPPP 683 Score = 36.7 bits (81), Expect = 0.027 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PPPPP GG PPPP PPP GGV PP P Sbjct: 653 PPPPPGGG-----MFPPPPPPPP--------GGGVPGPPKP 680 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -1 Query: 511 PPXP--GGGXKXXXGXGXGXXPPPPPGGXXXPG 419 PP P GG G G PPPPP G PG Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPG 676 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 591 GGGXXXXXPXPPXGGGGGXXXGXPXXPPP 505 GGG P PP GGG G P PPP Sbjct: 658 GGGMFPPPPPPPPGGG---VPGPPKPPPP 683 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +1 Query: 643 RXXXPPXGGXXXPPPPXXGAPPPXXP----XXXXPPXXPPP 753 R P GG PPP PPP P PP PPP Sbjct: 643 RPPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 680 PPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 P G PPP PP PPPP G Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPPGGG 673 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 448 GGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPP 549 GG PPP F PP GG PPPP Sbjct: 650 GGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 423 GXXXPPGGGGGXXPXPXPLXFFXPPPGXG 509 G PP GGG P P P PPPG G Sbjct: 650 GGIPPPPPGGGMFPPPPP-----PPPGGG 673 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 PPP PGGG PPPP GG P P Sbjct: 653 PPPPPGGGMFPPP------PPPPPGGGVPGPPKPP 681 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = -3 Query: 515 PPPPPXGG---XKKXKXXGGGXXSPPXP 441 PPPPP GG GGG PP P Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKP 680 Score = 27.9 bits (59), Expect(2) = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 PP P G PP P P PPP G Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGG 673 Score = 21.4 bits (43), Expect(2) = 1.6 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 850 PXPLPXXXPPXPPXPSXP 903 P P P P PP P P Sbjct: 666 PPPPPGGGVPGPPKPPPP 683 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP--PPXXXXXXXPPXPPPP 754 PPPP PPP P PPPP P G P P P PPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 PP PPPP PPP PP PP G Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSG 720 Score = 31.9 bits (69), Expect = 0.77 Identities = 24/96 (25%), Positives = 24/96 (25%), Gaps = 5/96 (5%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPX 616 P G P P P P PPPPP PPPP P P Sbjct: 657 PGGGQTISVNPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPV 716 Query: 617 XXXXXXGGVXXPPPPXGG-----XPXPPXXXXGXPP 709 G P P PP G P Sbjct: 717 QQSGAPGSPAGSPSGTSAGNPQQQPPPPGQLPGQQP 752 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPP 701 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 690 PPPPPPPPPPPPQPSTPPP 708 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/77 (27%), Positives = 23/77 (29%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEX 459 PP P P PP P PPPPP G+ G G + Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSG--TSAGNPQQQ 740 Query: 460 XPPPXXFXFFXPPXGGG 510 PPP P GG Sbjct: 741 PPPPGQLPGQQPGQAGG 757 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 653 PPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 PPP P PP PPP PP PPP Sbjct: 683 PPPPPPPPPPPP----PPPPPPPQPSTPPPPPP 711 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 850 PXPLPXXXPPXPPXPSXPP 906 P P P PP PP PS PP Sbjct: 689 PPPPPPPPPPPPPQPSTPP 707 Score = 29.5 bits (63), Expect = 4.1 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXX 717 PPPPP PPPP PPP PP PPPP PP Sbjct: 683 PPPPPP---------PPPPPPPPP---------------PPPPQPSTPPPPPPSTPPVQQ 718 Query: 718 PXXXXPPXXPPPXXXXG 768 P P G Sbjct: 719 SGAPGSPAGSPSGTSAG 735 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 S N S P P+ PP P PPPPPP Sbjct: 664 SVNPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPP 699 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P P PP PPP P PPPP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 698 PPPPQPSTPPPPPPSTPP 715 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P P P PPP PP PPPP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 587 PPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 PPP PPP P PPPP P PP PPP Sbjct: 683 PPPPPPPPP------------PPPP--PPPPPPQPSTPPPPP 710 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 686 PPPPPPPPPPPPPPPPQP 703 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGGG GG GGG G G GGGG G G G GGG Sbjct: 1776 GGGGMGGGGMAA--GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGA 1833 Query: 573 XXPXPPXGGGGG 538 GGGGG Sbjct: 1834 GGEGGGAGGGGG 1845 Score = 37.5 bits (83), Expect = 0.016 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -3 Query: 749 GGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXXX 570 GG GG G GGG GGGG GG GGG GGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGM----GGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Query: 569 XXXPPXGGGG 540 GGGG Sbjct: 1812 GGGGGMGGGG 1821 Score = 37.1 bits (82), Expect = 0.021 Identities = 31/115 (26%), Positives = 35/115 (30%), Gaps = 3/115 (2%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXG-GXGXPPXGGG--GXXTPPXXXXXXXGXGGGXGGGG 583 GG G GG GGG G G G GGG G G GG GGGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 582 XXXXXPXPPXGGGGGXXXGXPXXPPPXXGGGKKXKXXXGXXPFPPXPXGAAXXRG 418 GGG G GGG + + +A +G Sbjct: 1816 GMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGYSAQKSSSSFSYTSSSSSSAARKG 1870 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 368 GGGGGGXXKGXRRVTGGXAAPXXRGXGXGGXEXXG 264 GGGGGG G + GG G GG E G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGG 1794 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGGG G G G GG G GGGG G GG GGGG Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 6/63 (9%) Frame = -2 Query: 753 GGGGXG------GXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXG 592 GGGG G G GGG GG G GGGG G GGG G Sbjct: 53 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDG---DGGGGGDGGGGGDG 109 Query: 591 GGG 583 GGG Sbjct: 110 GGG 112 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGGG G G G GG G GGGG G GG GGGG Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 6/63 (9%) Frame = -2 Query: 753 GGGGXG------GXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXG 592 GGGG G G GGG GG G GGGG G GGG G Sbjct: 68 GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDG---DGGGGGDGGGGGDG 124 Query: 591 GGG 583 GGG Sbjct: 125 GGG 127 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/62 (40%), Positives = 26/62 (41%), Gaps = 2/62 (3%) Frame = +2 Query: 587 PPPXPPPXPXXXXXXXGGVXXPPPPXGGXPX--PPXXXXGXPPPXXXXXXXPPXPPPPXX 760 P PPP P GG+ PPP GG P PP PPP PP PPPP Sbjct: 276 PTSQPPPPPPLT----GGML--PPPFGGHPAAAPP------PPPLPAGVPAPPPPPPPPM 323 Query: 761 RG 766 G Sbjct: 324 LG 325 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +2 Query: 491 PPPXXGG----GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPP 607 PPP GG G P PPPPP PPPP PPP Sbjct: 283 PPPLTGGMLPPPFGGHPAAAPPPPPLPA---GVPAPPPPPPPP 322 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +1 Query: 655 PPXGGXXXPPP----PXXGAPPPXXPXXXXPPXXPPPXXXXG 768 PP G PPP P PPP P P PPP G Sbjct: 284 PPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLG 325 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 274 SXPPXPXPLXXGAAXPPVTRRXPFXXPPPPP 366 S PP P PL G PP P PPPPP Sbjct: 278 SQPPPPPPLTGGMLPPPFGGH-PAAAPPPPP 307 Score = 31.9 bits (69), Expect = 0.77 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 527 PXXXPPPPPX--GGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXP 676 P PPPPP GG P PP P PPPP G P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXPXXXXXXXXSPR 377 PPP GG G PPPPP P P P+ Sbjct: 283 PPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGPK 328 Score = 25.0 bits (52), Expect(2) = 1.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 841 AGXPXPLPXXXPPXPPXPSXP 903 A P PLP P PP P P Sbjct: 302 APPPPPLPAGVPAPPPPPPPP 322 Score = 24.2 bits (50), Expect(2) = 1.7 Identities = 11/26 (42%), Positives = 11/26 (42%), Gaps = 2/26 (7%) Frame = +1 Query: 679 PPPPXXGA--PPPXXPXXXXPPXXPP 750 PPPP G PPP P PP Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPP 307 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 37.9 bits (84), Expect = 0.012 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 7/79 (8%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPP-------XPXXXXXXXGGVXXPPPPXGGXPXPPXXXX 697 P PPP P PP PPP P PPP PP Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPAT 965 Query: 698 GXPPPXXXXXXXPPXPPPP 754 PPP PP PPPP Sbjct: 966 QVPPP-----PLPPLPPPP 979 Score = 37.1 bits (82), Expect = 0.021 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 5/76 (6%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXP-----PPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGA 702 PPPP PPPP P P R PP PP P Sbjct: 908 PPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQV 967 Query: 703 PPPXXPXXXXPPXXPP 750 PPP P PP PP Sbjct: 968 PPP--PLPPLPPPPPP 981 Score = 36.3 bits (80), Expect = 0.036 Identities = 21/77 (27%), Positives = 23/77 (29%), Gaps = 2/77 (2%) Frame = +1 Query: 682 PPPXXGAPPPXXP--XXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPX 855 P P APPP P PP PPP + P Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPP 960 Query: 856 PLPXXXPPXPPXPSXPP 906 P+P P PP P PP Sbjct: 961 PIPATQVPPPPLPPLPP 977 Score = 33.5 bits (73), Expect = 0.25 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 1/87 (1%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPP-PXG 667 PPP P PPPPP P P PPP P Sbjct: 908 PPPPLPLAPEPPPPLPPPPPPI--QTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPAT 965 Query: 668 GXPXPPXXXXGXPPPXXXXXXXPPXPP 748 P PP PPP P PP Sbjct: 966 QVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP PL P PP P PP Sbjct: 908 PPPPLPLAPEPPPPLPPPP 926 Score = 29.1 bits (62), Expect = 5.5 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +2 Query: 653 PPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRGXXXXXXXXXXXXXXXXXXXXXX 832 P P P PP PPP PP PPPP Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPL-----PP-PPPPIQTTRPTVPTTPTTQASTTRPTPPPP 954 Query: 833 XXXXGXPXPSXXXXPPXPXPPXXPP 907 P P+ PP P PP PP Sbjct: 955 TSALPPPIPA-TQVPPPPLPPLPPP 978 Score = 28.3 bits (60), Expect = 9.5 Identities = 19/74 (25%), Positives = 20/74 (27%), Gaps = 7/74 (9%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPP-------PXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXX 696 PPPPP P P PPP + PP PPPP Sbjct: 924 PPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQ 983 Query: 697 GAPPPXXPXXXXPP 738 P P P Sbjct: 984 TTTAPTLPPASCMP 997 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXP-XXXXPPXXPP 750 PP PPPP PPP P P PP Sbjct: 960 PPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 P PPPPP PPPP PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.5 bits (78), Expect(2) = 0.014 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPPP PPP P PP PPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPP 607 P PPPPP PPPP PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPPP PPP PP PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 643 RXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPP 738 R PP PPPP +PPP P PP Sbjct: 1153 RDQIPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPP 685 PPPP PPP P PPPP P PP Sbjct: 1157 PPPPPPPPPPPP------SSPSPPPPPPPPPPPP 1184 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 641 VXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 + PPPP P PP PPP PP PPPP Sbjct: 1156 IPPPPPP---PPPPPPSSPSPPPP------PPPPPPPP 1184 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPPP P PP PPP PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP-----PPPPPTP 1186 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXP 613 PPPPP PPP PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P P PP P PP Sbjct: 1163 PPPPPPSSPSPPPPPPPPP 1181 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P P P PPPP P PP Sbjct: 1166 PPPSSPSPPPPPPPPPPPP 1184 Score = 21.0 bits (42), Expect(2) = 0.014 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 856 PLPXXXPPXPPXPS 897 P P PP PP P+ Sbjct: 1174 PPPPPPPPPPPTPT 1187 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 37.5 bits (83), Expect = 0.016 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 5/78 (6%) Frame = +2 Query: 548 PPXGGXGXXXXX--PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXP-PXXXXGXPPPXX 718 PP GG G P P PPP P PP P GG P P P P Sbjct: 5 PPPGGYGMYGYGGMPRPGAPPPMPQQPPPLGFDAMGPPQP-GGMPMPMPGPYPSSGYPTS 63 Query: 719 XXXXXPP--XPPPPXXRG 766 PP PPPP G Sbjct: 64 VPGAAPPYGGPPPPVSCG 81 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +2 Query: 521 GXPXXXP-PPPPXGGXGXXXXXP-PPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXP 682 G P P PPP G P P P P P V PP GG P P Sbjct: 22 GAPPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPPP 77 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +2 Query: 590 PPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 PP PP P PPPP G PP G PP PP P PP G Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPP-GAPAAPPAPPFGGPP-----SAPPPPPAPPVGGG 213 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGG 384 PP P P AA P P PPPPP GG Sbjct: 178 PPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGG 212 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPP-PPXGGXPXPPXXXXGXP 706 PP PP PP PPP G PP PP GG P P P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPP--------PGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPPPXGGXGXXXXXP---PPPXPPPXP 613 PP P P PPP G P PP PPP P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +1 Query: 583 PPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXX 762 P PP PP PP G PP P G PP P P PP Sbjct: 162 PQPPAPPAAPFMAPAAPPAP----PPPGAPAAPPAPPFGGPPSAPP-----PPPAPPVGG 212 Query: 763 XG 768 G Sbjct: 213 GG 214 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 542 PPPPXGGXGXXXXXPPPPXPPPXPXXXXXXX-GGVXXPPPPXGGXPXPPXXXXG 700 PP P PP P PP P GG PPP P PP G Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPP---PPAPPVGGGG 214 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 37.5 bits (83), Expect = 0.016 Identities = 30/76 (39%), Positives = 30/76 (39%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGGG GG GGG GG G GGGG G GGG GGGG Sbjct: 62 GGGGGGGGGGGGGGGGGG-----GGGGDDGDGGGGDG--------GGGGGGGDGGGG--- 105 Query: 573 XXPXPPXGGGGGXXXG 526 GGGGG G Sbjct: 106 -------GGGGGGGVG 114 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGGG G GGG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG G GGG G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGGG G GGG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGG G G GGG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GG GG G GGG Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG G GGG G GGG Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGGG G GGG Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 36.7 bits (81), Expect = 0.027 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GG G G GGG GG GGGG G GG GGGG Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGG 103 Score = 33.1 bits (72), Expect = 0.33 Identities = 25/76 (32%), Positives = 25/76 (32%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGGG GG GG GG G GGG G GGG G GG Sbjct: 35 GGGGVGGGGGNG--GGAGNGVGAGGCGC---GGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Query: 573 XXPXPPXGGGGGXXXG 526 G GG G Sbjct: 90 AAGAGAGGNVGGGGSG 105 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGG GG G G G G G GG G GG G G Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Query: 573 XXPXPPXGGGG 541 G GG Sbjct: 96 GGNVGGGGSGG 106 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -2 Query: 684 GGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPP 505 GG G GG G G GGG GG GGGGG G Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGN--GGGGGGAGNGGAAGAAG 92 Query: 504 XXGGG 490 GG Sbjct: 93 AGAGG 97 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GG G GG GGG GG G GG G GG G GG Sbjct: 56 GGCGCGGGNDGGNGGGGA---GNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGG GG GGG GG G G G G GG GG G Sbjct: 61 GGGNDGG------NGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.027 Identities = 31/114 (27%), Positives = 31/114 (27%), Gaps = 2/114 (1%) Frame = +1 Query: 415 AXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPP--PPPXGGXXXXXXXPP 588 A PG P PP PP G P PPP PP Sbjct: 8 AIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPN---IPIPGNPP 64 Query: 589 PPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPP 750 P P P G P G P P G PPP P PP P Sbjct: 65 PNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 34.3 bits (75), Expect = 0.14 Identities = 27/100 (27%), Positives = 27/100 (27%), Gaps = 2/100 (2%) Frame = +2 Query: 458 GXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXG 637 G P PPP P P P PP P P G Sbjct: 2 GTPPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPG 61 Query: 638 GVXXPPP--PXGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 PPP P G P P G PPP PP P Sbjct: 62 N---PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTP 98 Score = 29.5 bits (63), Expect = 4.1 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Frame = +2 Query: 542 PPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXX 721 PPP G PPP P G P P G P P G PPP Sbjct: 13 PPPNTAIPGD----PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTP 68 Query: 722 XXXXPP-XPPPP 754 PP P P Sbjct: 69 IPGDPPPNTPIP 80 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PP PP PPPP PP P V PPPP Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPP 338 Score = 31.9 bits (69), Expect = 0.77 Identities = 24/82 (29%), Positives = 25/82 (30%), Gaps = 8/82 (9%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPP-PXGGXGXXXXXPP----PPXPPPXPXXXXXXXGGVXXPP 655 PPP P PPPP P PP PP PPP + P Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPS 356 Query: 656 PPXGGXPXP---PXXXXGXPPP 712 PP P P PPP Sbjct: 357 PPEDLYDAPATLPSPIMPPPPP 378 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXP-PPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPX 714 PPPPP P PP + PP PPP APPP Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPM----TPPPAVVTAPPPA 300 Query: 715 XPXXXXPPXXPPP 753 P PPP Sbjct: 301 PPLPNFTSPSPPP 313 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +2 Query: 512 GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXX 691 G G PPPPP P P V P P PP Sbjct: 236 GRLGLSNIKPPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPP--MTPPPAV 293 Query: 692 XXGXPPPXXXXXXXPPXPPPP 754 PP P PPPP Sbjct: 294 VTAPPPAPPLPNFTSPSPPPP 314 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 32.7 bits (71), Expect(2) = 0.033 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPPP PPP P P PPP Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPP 580 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 650 PPPPXG---GXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 PPPP G P PP PPP P PPP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXG 667 P PPPPP G PP P P P PPPP G Sbjct: 550 PSEEPPPPPPG-VDIPPPLPPSEDPKPPPPPPEPPE---ECPPPPPG 592 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 655 PPXGGXXXPPP-PXXGAPPPXXPXXXXPPXXPPP 753 PP G PPP P P P P P PPP Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 650 PPPPXGGXPXP-PXXXXGXPPPXXXXXXXPPXPPPP 754 PPPP P P P PPP PPPP Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 22.6 bits (46), Expect(2) = 0.033 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 856 PLPXXXPPXPPXPSXPP 906 P P PP PP PP Sbjct: 573 PKPPPPPPEPPEECPPP 589 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 36.3 bits (80), Expect = 0.036 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 P PPPPP PPPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.9 bits (79), Expect = 0.047 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 509 GGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 G G PPPPP PPPP PPP P Sbjct: 455 GDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 35.5 bits (78), Expect = 0.063 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPPP PPP P PP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 35.5 bits (78), Expect = 0.063 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPPP PPP P PP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 35.1 bits (77), Expect = 0.083 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 PPPP PPP P PPPP P PP PPP Sbjct: 464 PPPPPPPPPP------------PPPPPPPPPPPPPPFPPPPPP 494 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 PP PPPP PPP P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 560 GXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPP 685 G G PPPP PPP P PPPP P PP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPP------PPPPPPPFPPPPPP 494 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 506 GGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 G G P PPPPP PPP PPP P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 635 GGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 G PPPP P PP PPP PP PPP Sbjct: 461 GQAPPPPPPPPPPPPPP-----PPPPPPPPPPFPPPPPP 494 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPP 482 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPP 483 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPP 484 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 PP P P PP PF PPPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPP 485 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 468 PPPPPPPPPPPPPPPPPPP 486 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 469 PPPPPPPPPPPPPPPPPPP 487 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 472 PPPPPPPPPPPPPPPPFPP 490 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 473 PPPPPPPPPPPPPPPFPPP 491 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 474 PPPPPPPPPPPPPPFPPPP 492 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 476 PPPPPPPPPPPPFPPPPPP 494 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 PP P P PP P PPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 AGXPXPLPXXXPPXPPXPSXPP 906 A P P P PP PP P PP Sbjct: 463 APPPPPPPPPPPPPPPPPPPPP 484 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 36.3 bits (80), Expect = 0.036 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -2 Query: 765 PRXXGGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 PR GGG G GGG GG G GGGG G GGG GG Sbjct: 174 PRGDSGGG-GSQGGGYRSGGGGYGGSKGGYGGGS-GGGGYGGGRGGGGYGGGHGGGGYGG 231 Query: 585 GXXXXXPXPPXGGG 544 G GGG Sbjct: 232 GGRHDYGGGSKGGG 245 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 36.3 bits (80), Expect = 0.036 Identities = 30/100 (30%), Positives = 33/100 (33%), Gaps = 1/100 (1%) Frame = -2 Query: 753 GGGGXG-GXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXX 577 GG G G G GGG GG G P GG G + G G GGG Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWG 65 Query: 576 XXXPXPPXGGGGGXXXGXPXXPPPXXGGGKKXKXXXGXXP 457 GGG G G P G G+ + G P Sbjct: 66 RM-----QGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGP 100 Score = 30.7 bits (66), Expect = 1.8 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 2/81 (2%) Frame = -2 Query: 762 RXXGGG-GXG-GXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGG 589 R GGG G G G GGG GG G P GG G G G G G Sbjct: 26 RGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQG-GGMGRGPGGGLGRGP 84 Query: 588 GGXXXXXPXPPXGGGGGXXXG 526 GG G G G G Sbjct: 85 GGGWGRMQEGGMGRGPGQGWG 105 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 G GG GG GGG GG G GGGG G GGG GGGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG------------GGGGGGGGGG 701 Score = 35.1 bits (77), Expect = 0.083 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GG G GG GGG GG G GGGG G GGG GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG---------GGGGGGGGAGGAG 706 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 681 GXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G G GGGG G GGG GGGG GG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 684 GGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 GG G GGGG G GGG GGGG G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 33.5 bits (73), Expect = 0.25 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 684 GGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 GG G GGGG G GGG GGGG GGGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-------GGGGGGGAGG 704 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGGGG G GGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 606 GGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GGG GGGG GGGGG G GGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GG GGGG GGGGG G GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GG GGGG GGGGG G GGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 35.9 bits (79), Expect = 0.047 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 590 PPXPPPXPXXXXXXXGGVXXPPPP-XGGXPXPPXXXXG 700 PP PPP P GG+ PPPP GG P PP G Sbjct: 195 PPPPPPGP-------GGIPPPPPPIRGGVPPPPPMGGG 225 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPPPP G G PPPP P GGV PPP GG Sbjct: 195 PPPPPPGPGG----IPPPPPP---------IRGGVPPPPPMGGG 225 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 256 ERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGG 384 E +P S PP P P G PP P PPPP GG Sbjct: 187 EDTPWTSVPPPPPPGPGGIPPPP----PPIRGGVPPPPPMGGG 225 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 514 PPPXPGGGXKXXXGXGXGXXPPPPPGG 434 PPP PGG G PPPP GG Sbjct: 198 PPPGPGGIPPPPPPIRGGVPPPPPMGG 224 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 435 PPGGGGGXXPXPXPLXFFXPPPGXGGG 515 PP G GG P P P+ PPP GG Sbjct: 198 PPPGPGGIPPPPPPIRGGVPPPPPMGG 224 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -1 Query: 514 PPPXPG-GGXKXXXGXGXGXXPPPPPGG 434 PPP PG GG G PPPPP G Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPPMG 223 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPP 712 PPP GG P PP G PP Sbjct: 198 PPPGPGGIPPPPPPIRGGVPP 218 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXP 720 P GG PPPP G PP P Sbjct: 200 PGPGGIPPPPPPIRGGVPPPPP 221 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 658 PXGGXXXPPPPXXGA-PPPXXPXXXXPPXXPP 750 P PPPP G PPP P P PP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 641 VXXPPPPXGG--XPXPPXXXXGXPPP 712 V PPPP G P PP G PPP Sbjct: 194 VPPPPPPGPGGIPPPPPPIRGGVPPP 219 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 35.9 bits (79), Expect = 0.047 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 635 GGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 GG PPPP G P PP PPP P P PP Sbjct: 118 GGYVPPPPPTGTLPPPPV----TPPPGPETPPPPDTPAPP 153 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 PPPPP G PPP PPP P PPP P PP PP Sbjct: 122 PPPPPTG-----TLPPPPVTPPPGPETP---------PPPDTPAPPVPPTEAPPTAPP 165 Score = 32.7 bits (71), Expect = 0.44 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 GGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 GG PPPP PPP P PPP Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPPP 147 Score = 31.9 bits (69), Expect = 0.77 Identities = 25/71 (35%), Positives = 25/71 (35%) Frame = +1 Query: 538 PPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXX 717 PPPPP G PPPP PP G PPPP APP Sbjct: 122 PPPPPTG------TLPPPPVTPPP-------------------GPETPPPPDTPAPP--V 154 Query: 718 PXXXXPPXXPP 750 P PP PP Sbjct: 155 PPTEAPPTAPP 165 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +1 Query: 655 PPXGGXXXPPP--PXXG---APPPXXPXXXXPPXXPPP 753 PP G PPP P G PPP P PP PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 PP G P PPP P P PP PP GG PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPE--TPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 35.9 bits (79), Expect = 0.047 Identities = 35/145 (24%), Positives = 38/145 (26%) Frame = +1 Query: 319 PPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXPPPXXFXFFXPP 498 PP+ +R PPP P GG G P GG P + Sbjct: 102 PPLQQRQQH--PPPGHPPMGGGYPGQQPG--GPPPSYDSTMQQGGSYPPGQQPYP----- 152 Query: 499 XGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXX 678 G P P G P P P G P Sbjct: 153 -----GQQAYPGQPGASPQGQPYPGQSYPQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMW 207 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPP G PP P PP PPP Sbjct: 208 GPPPMGGPPPMGGPPGGYPPPPPPP 232 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 508 PXPGGGXKXXXGXGXGXXPPPPPGGXXXPGXXP 410 P P GG G G PPPPP G P P Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 Score = 31.5 bits (68), Expect = 1.0 Identities = 24/82 (29%), Positives = 24/82 (29%) Frame = +2 Query: 521 GXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXG 700 G P P P G P P P G P P G PP G Sbjct: 159 GQPGASPQGQPYPGQSYPQGQEPYPEKGGYPPAGVGQHSG---PYPGQPGMWGPPPM--G 213 Query: 701 XPPPXXXXXXXPPXPPPPXXRG 766 PPP P PPPP G Sbjct: 214 GPPPMGGPPGGYPPPPPPPGAG 235 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = -3 Query: 560 PPXGGGGGXXXXXXXPP---PPPXGGXKKXKXXGGGXXSPPXPXGXXXPGXAP 411 PP G G P PPP GG GG PP P G P P Sbjct: 189 PPAGVGQHSGPYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 35.9 bits (79), Expect = 0.047 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP P P PP PPP PP PPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPP 738 PP PPPP PPP P P Sbjct: 226 PPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 P P+ P P P PP P PPPPPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPP---PPPPPP 249 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXP 613 PPPP PPP PPP P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 35.9 bits (79), Expect = 0.047 Identities = 24/75 (32%), Positives = 24/75 (32%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 P P PPP PPP P P P PPPP P PP P Sbjct: 1043 PPRKPSPPPSA-----VPIPPPRKPSPPPSEPAPPP---RQPPPPSTSQPVPPPR---QP 1091 Query: 707 PPXXXXXXXPPXPPP 751 P P PPP Sbjct: 1092 DPIPTNPAHPTEPPP 1106 Score = 33.1 bits (72), Expect = 0.33 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPP----PXGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 PP P P P V PPP P P PP PPP PP P Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQ--PPPPSTSQPVPPPRQPD 1092 Query: 752 P 754 P Sbjct: 1093 P 1093 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP P P P PPP P PP PPP PPP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPR--KPSPPPSAVPIPPPRKPSPPPSEPAPPP 1073 Score = 28.7 bits (61), Expect = 7.2 Identities = 20/77 (25%), Positives = 20/77 (25%), Gaps = 2/77 (2%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXP--PXXXXG 700 P PP P PP P P PPP P P P Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPR 1074 Query: 701 XPPPXXXXXXXPPXPPP 751 PPP PP P Sbjct: 1075 QPPPPSTSQPVPPPRQP 1091 Score = 28.3 bits (60), Expect = 9.5 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 6/63 (9%) Frame = +1 Query: 583 PPP---PXPPPXXXXXXXXXXGXRXXXPPXGGXXXP-PPPXXGAPPPXXPXXXX--PPXX 744 PPP P PPP PP P PPP P P P PP Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQ 1108 Query: 745 PPP 753 P P Sbjct: 1109 PKP 1111 >SB_4337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 423 Score = 35.9 bits (79), Expect = 0.047 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 4/96 (4%) Frame = +2 Query: 437 PXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPP----XPP 604 P G G G P PP G G PPP G G PPP PP Sbjct: 244 PPGQQGYGPPPGQQGYGAPPGQQGYGPPLGQQGYGPPPGQQGYG-----PPPGQQGYGPP 298 Query: 605 PXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 P G PPP PP G PP Sbjct: 299 PGQQGYGSPPGQQGYGPPPGQQGYGPPAGQQGYGPP 334 Score = 32.3 bits (70), Expect = 0.59 Identities = 27/101 (26%), Positives = 29/101 (28%), Gaps = 7/101 (6%) Frame = +2 Query: 485 FXPP---PXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPP 655 + PP P G G PPP G G PP PP Sbjct: 221 YGPPGQQPGSPGQHQGYGTLPGPPPGQQGYGPPPGQQGYGAPPGQQGYGPPLGQQGYGPP 280 Query: 656 PPXGGXPXPPXXXXGXPPPXXXXXXXPPXP----PPPXXRG 766 P G PP PPP PP PPP +G Sbjct: 281 PGQQGYGPPPGQQGYGPPPGQQGYGSPPGQQGYGPPPGQQG 321 Score = 29.5 bits (63), Expect = 4.1 Identities = 30/121 (24%), Positives = 30/121 (24%), Gaps = 4/121 (3%) Frame = +1 Query: 361 PPPXXXGGXXXXXXXXXGAXPGXXX---PXGXGGEXXPPPXXFXFFXPPXG-GGGGXXXX 528 PPP G G PG P G G P F P GG Sbjct: 297 PPPGQQGYGSPPGQQGYGPPPGQQGYGPPAGQQGYGPPQGQQQGFSGPSLAVGGDTDTPS 356 Query: 529 XXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPP 708 P PPPP PP G PPPP PP Sbjct: 357 YQGADVPDQDVEGNENAAPPPPSAPPASLFAGIQGY----ENVQYGNEFLPPPPPYEPPP 412 Query: 709 P 711 P Sbjct: 413 P 413 Score = 28.7 bits (61), Expect = 7.2 Identities = 28/99 (28%), Positives = 29/99 (29%) Frame = +2 Query: 443 GXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXX 622 G G P + PPP G P PP G G PPP P Sbjct: 236 GYGTLPGPPPGQQGYGPPPGQQG-YGAPPGQQGYGPPLGQQGYG---PPPGQQGYGPPPG 291 Query: 623 XXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPP 739 G PPP G PP PPP PP Sbjct: 292 QQGYG----PPPGQQGYGSPPGQQGYGPPPGQQ-GYGPP 325 Score = 28.3 bits (60), Expect = 9.5 Identities = 32/119 (26%), Positives = 33/119 (27%), Gaps = 12/119 (10%) Frame = +2 Query: 434 APXGXGGXGXXPXXXXXFXPPPXXGG-GXXGXPXXXPPPPPXGGXGXXXXXP---PPP-- 595 AP G G G P + PPP G G PPP G G PPP Sbjct: 261 APPGQQGYGP-PLGQQGYGPPPGQQGYGPPPGQQGYGPPPGQQGYGSPPGQQGYGPPPGQ 319 Query: 596 ---XPPPXPXXXXXXXG---GVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP G G P GG P P PPPP Sbjct: 320 QGYGPPAGQQGYGPPQGQQQGFSGPSLAVGGDTDTPSYQGADVPDQDVEGNENAAPPPP 378 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 35.5 bits (78), Expect = 0.063 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 1/89 (1%) Frame = -2 Query: 753 GGGGXG-GXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXX 577 GG G G G GGG GG G GG G G G G GGG Sbjct: 266 GGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGR 325 Query: 576 XXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG G GGG Sbjct: 326 MQGGGMGRGPGGGLGRGPGGGWGRMQGGG 354 Score = 33.9 bits (74), Expect = 0.19 Identities = 30/95 (31%), Positives = 32/95 (33%), Gaps = 2/95 (2%) Frame = -2 Query: 765 PRXXGGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXT-PPXXXXXXXGXGGGXGG 589 PR G G GG GGG G G P GG G + G G G GG Sbjct: 249 PRGWGRGSGGGWGQGP--GGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGG 306 Query: 588 G-GXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGGK 487 G G GGG G G P G G+ Sbjct: 307 GWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGR 341 Score = 31.1 bits (67), Expect = 1.4 Identities = 31/111 (27%), Positives = 33/111 (29%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGXXX 573 GGG G G GG G GG G R P G G GGG Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGP------GGGWGRGSGGGWGRM 295 Query: 572 XXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXSPPXPXGXXXPG 420 G GGG P GG + + GGG P PG Sbjct: 296 QGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQ--GGGMGRGPGGGLGRGPG 344 Score = 30.7 bits (66), Expect = 1.8 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXG-GGGXX 577 GG G GGG GG G P GG G P G G G G G G Sbjct: 306 GGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRG-PGGGWGRMQGGGMGRGPGQGWG 364 Query: 576 XXXPXPPXGGGGGXXXGXPXXP 511 G G G G P P Sbjct: 365 CRGMGCGWGCGNGRFGGCPRIP 386 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 35.1 bits (77), Expect = 0.083 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 585 PPPPPPPXXXXXXXXXXGXSXXXPPRGGGXXPPPXXXGGXP 707 PPPPP G P RGGG PP GG P Sbjct: 441 PPPPPQQAARINYRASYGAPPLPPKRGGGPPLPPKRGGGPP 481 Score = 32.7 bits (71), Expect = 0.44 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 585 PPPPPPPXXXXXXXXXXGXSXXXPPRGGGXXPPPXXXGGXPPP 713 PPPPP G P RGGG PP P P Sbjct: 300 PPPPPQQAARIDYRASYGAPPLPPKRGGGPPLPPKRVANIPSP 342 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXG----GVXXPPPPXGGXPXPPXXXXGXP 706 P PP G P PPP P G PP GG P P G P Sbjct: 421 PEPPLKAGDSPLKRSVKKPLPPPPPQQAARINYRASYGAPPLPPKRGGGPPLPPKRGGGP 480 Query: 707 P 709 P Sbjct: 481 P 481 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 1/73 (1%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP-PPX 715 P PP G P PPP P G P PP G P PP Sbjct: 280 PEPPLKAGDSPLKRSVKKPLPPPPPQQAARIDYRASY-----GAPPLPPKRGGGPPLPPK 334 Query: 716 XXXXXXPPXPPPP 754 P P PP Sbjct: 335 RVANIPSPKPRPP 347 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 583 PPPPXPPPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPP 711 P PP PP PP G P PP G PP Sbjct: 439 PLPPPPPQQAARINYRASYGAPPLPPKRGGGPPLPPKRGGGPP 481 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = +1 Query: 496 PXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGXRXXXPPXGGXX 675 P G GG PPP P PP PP PP G Sbjct: 214 PPGRPGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPTTSMSGPPIPV--HHGMPPQYGPG 271 Query: 676 XPPPPXXGAPPPXXPXXXXPPXXPP 750 P GAPP P P PP Sbjct: 272 RRDMPPPGAPPGMLPPGMPPHGMPP 296 Score = 28.3 bits (60), Expect = 9.5 Identities = 23/84 (27%), Positives = 23/84 (27%), Gaps = 2/84 (2%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPP--PXG 667 PP GG P PP PP PP PP PP P Sbjct: 214 PPGRPGGPGMPPGGPPPFPPTSDPN-MGHHPPISGPPTTSMSGPPIPVHHGMPPQYGPGR 272 Query: 668 GXPXPPXXXXGXPPPXXXXXXXPP 739 PP G PP PP Sbjct: 273 RDMPPPGAPPGMLPPGMPPHGMPP 296 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 34.7 bits (76), Expect = 0.11 Identities = 44/183 (24%), Positives = 48/183 (26%), Gaps = 15/183 (8%) Frame = +2 Query: 251 KRNEAXTXPXRRX-PXPXXGGPPPPP*XDGXPSVFXXXXXXXXXGGXXXXXXXXXXXPRX 427 +RN A T P ++ P P PPP P GG P Sbjct: 704 QRNSATTPPPQQAYTSPPSSAPAPPP-----PQYNQASMQQLQYGGPQQYQHPHANTPSP 758 Query: 428 XAAPXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPP 607 + P P G PP GG PPP PP Sbjct: 759 TPHQQYQHPQNAGLPADNTYNPSPQGDPNQGGQQPGYGAPPTQGGP--PQAQPPPHAPPG 816 Query: 608 XPXXXXXXX-----GGVXX---PPPPXGGXPXP------PXXXXGXPPPXXXXXXXPPXP 745 GG PPPP G P P P G PPP P Sbjct: 817 QAHYQQLGAAAPNQGGYHPQQPPPPPQGYEPQPQYQPQGPPQYYGGPPPQQQQQRQPQSG 876 Query: 746 PPP 754 PPP Sbjct: 877 PPP 879 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 34.3 bits (75), Expect = 0.14 Identities = 29/102 (28%), Positives = 29/102 (28%), Gaps = 5/102 (4%) Frame = +2 Query: 419 PRXXAAPXGXGGXGXXPXXXXXFXPPPXXG-----GGXXGXPXXXPPPPPXGGXGXXXXX 583 P A P G G P PP G G G P PP P G G Sbjct: 1784 PPGLAGPQGPKGMPGPPGPPG---PPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWP 1840 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPP 709 P P P G PP G P PP G P Sbjct: 1841 GVPGPPGPPGAYGWKGYPGNPAGPPGRDGIPGPPGRQGGKGP 1882 Score = 32.7 bits (71), Expect = 0.44 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPP G G P P G G PP P P G PP G Sbjct: 1664 PPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP---QGIPGYPGAPAGPPGRDG 1720 Query: 671 XPXPPXXXXGXPPP 712 PP G PP Sbjct: 1721 PMGPPGPSGGQGPP 1734 Score = 31.9 bits (69), Expect = 0.77 Identities = 27/105 (25%), Positives = 28/105 (26%), Gaps = 1/105 (0%) Frame = +1 Query: 424 GXXXPXGXGGEXXPP-PXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXP 600 G P G G PP P + G G P PP G P PP P Sbjct: 1789 GPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGP 1848 Query: 601 PPXXXXXXXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXP 735 P G P G PP G P P P Sbjct: 1849 P--GAYGWKGYPGNPAGPPGRDGIPGPPGRQGGKGPAGIPGIPGP 1891 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = +2 Query: 545 PPPXGGXGXXXXXPPPPXPPPXPXXXXXXXG-GVXXPPPPXGGXPXPPXXXXGXPPPXXX 721 PP G P PP PP P G PP G P PP P Sbjct: 1784 PPGLAGPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQG---PKGWP 1840 Query: 722 XXXXPPXPP 748 PP PP Sbjct: 1841 GVPGPPGPP 1849 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 2/75 (2%) Frame = +1 Query: 343 FXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXPP--PXXFXFFXPPXGGGGG 516 + PPPPPP G PG P G G PP P P G Sbjct: 1659 YPAPPPPPPPAPGPPGPDGPM---GLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP 1715 Query: 517 XXXXXXXPPPPPXGG 561 PP P GG Sbjct: 1716 PGRDGPMGPPGPSGG 1730 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXR 763 P PP PPP G + P P P P G P P PP Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRD 1719 Query: 764 G 766 G Sbjct: 1720 G 1720 Score = 30.7 bits (66), Expect = 1.8 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 6/97 (6%) Frame = +2 Query: 494 PPXXGG--GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPP--PXPXXXXXXXGGVXXPPPP 661 PP G G G P PP P G G P PP P G P P Sbjct: 1784 PPGLAGPQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVP 1843 Query: 662 XGGXPXPPXXXX--GXPPPXXXXXXXPPXPPPPXXRG 766 G P PP G P P PP +G Sbjct: 1844 --GPPGPPGAYGWKGYPGNPAGPPGRDGIPGPPGRQG 1878 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXP-PPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPX 715 PPPPP G P P P P G P P G P P G PP Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQ--GIPGYPGAPAG--PPG 1717 Query: 716 XXXXXXPPXP 745 PP P Sbjct: 1718 RDGPMGPPGP 1727 Score = 28.7 bits (61), Expect = 7.2 Identities = 25/98 (25%), Positives = 25/98 (25%) Frame = +1 Query: 265 PNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXG 444 P PP P P P PP PP G PG G Sbjct: 1797 PGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPPGAYGWKG 1856 Query: 445 XGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXG 558 G PP PP G GG P P G Sbjct: 1857 YPGNPAGPPGRDGIPGPP-GRQGGKGPAGIPGIPGPGG 1893 Score = 28.3 bits (60), Expect = 9.5 Identities = 24/78 (30%), Positives = 26/78 (33%) Frame = -2 Query: 711 GGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXX 532 G P G G P G G PP G G G P PP GG Sbjct: 1826 GPPGPPGPQGPKGWP--GVPGPPGPPGAYGWK-GYPGNPAGPPGRDGIPGPPGRQGGKGP 1882 Query: 531 XGXPXXPPPXXGGGKKXK 478 G P P P G GK+ + Sbjct: 1883 AGIPGIPGP-GGVGKRRR 1899 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 7/82 (8%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGV-------XXPPPPXGGXPXPP 685 P PPPP PPPP PPP P V PPPP P P Sbjct: 97 PACCAPPPP-----PPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 Query: 686 XXXXGXPPPXXXXXXXPPXPPP 751 PP PPP Sbjct: 152 PCHQTQVVHSVQLHASPPGPPP 173 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 685 PPXXGAPPPXXPXXXXPPXXPPP 753 PP APPP P PP PPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPP 118 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPPP PPP P PPPP P PP PPPP Sbjct: 102 PPPPPPPPPP------------PPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 682 PPPXXGAPPPXXPXXXXPPXXPPP 753 PP PPP P PP PPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 680 PPXXXXGXPPPXXXXXXXPPXPPPP 754 PP PPP PP PPPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGG 649 GGGG GG GGG GG G GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGG 649 GGGG GG GGG GG G GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 684 GGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GG G GGGG G GGG GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 684 GGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GG G GGGG G GGG GGGG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G GGG GGGG GGGGG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPP 748 PPPP PP P P P G P PP G P PP PP Sbjct: 777 PPPPPPPTKPATPRVPPN---IPSRPPGARPTPPPPPPG-KPTKPTKPSLPPVPP 827 Score = 30.7 bits (66), Expect = 1.8 Identities = 38/156 (24%), Positives = 38/156 (24%), Gaps = 3/156 (1%) Frame = +1 Query: 289 PXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXP- 465 P P A PPVTRR P PP P G P P Sbjct: 679 PPPYSDVAMVPPVTRRPP---PPRPMAPKDASLHRASSPPGFTHKGSEPPPKPAPPARPG 735 Query: 466 -PPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXXXXXXXGX 642 P G G PPP PPP Sbjct: 736 SVANVLGERKPLPGRRPGVEWPPLAKSSSDGAAIDKKALGAPPPPPPPTKPATPRVP--P 793 Query: 643 RXXXPPXGGXXXPPPPXXGAP-PPXXPXXXXPPXXP 747 P G PPPP G P P P PP P Sbjct: 794 NIPSRPPGARPTPPPPPPGKPTKPTKP--SLPPVPP 827 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPP 751 PPPP P P P PP PPP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPP 811 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGG 649 GGGG GG GGG GG G GGGG Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGGGG G GGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 31.9 bits (69), Expect = 0.77 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -2 Query: 684 GGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXP 511 GG G GGGG G GGG GGGG GGGGG G P Sbjct: 81 GGRGGG-FGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGG----FGGGGGGGFGSRARP 133 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 GG GG GGG GG G GGGG G GGG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGG---------GGGGFGGGGGGG 126 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGG 654 GGG GG G GGG GGGG GG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 747 GGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GG GG GGG GG G GGGG G GGG GGGG Sbjct: 81 GGRGGGF-----GGGGGFGGGGGGGFGGGGGGG-------FGGGGGGGGGFGGGG 123 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGG 649 G GG GG GGG GG G GGGG Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGG 649 GGG GG GGG GG G GGGG Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXR 642 GGG GG G G G GGGG GG R Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGG 649 GG G GG GGG GG G GGGG Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGGGG G GGG Sbjct: 88 GGGGGFGGGGGGGFG-----GGGGGGFGGGGGGGGGFGGGG 123 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 638 GVXXPPPPXGGXPXPPXXXXGX--PPPXXXXXXXPPXPPPP 754 G+ PPP G PP G PPP PP P PP Sbjct: 175 GILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPP 750 P PP APPP P PP PP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPP 204 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 33.5 bits (73), Expect = 0.25 Identities = 28/101 (27%), Positives = 28/101 (27%), Gaps = 13/101 (12%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPP-----XGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPP 655 PPP G P PPP G PPP PP V PP Sbjct: 363 PPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPP 422 Query: 656 P----PXGGXP----XPPXXXXGXPPPXXXXXXXPPXPPPP 754 P P G P PP PP PPP Sbjct: 423 PSVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPPPAPPP 463 Score = 29.5 bits (63), Expect = 4.1 Identities = 30/132 (22%), Positives = 32/132 (24%), Gaps = 11/132 (8%) Frame = +1 Query: 541 PPPPXGGXXXXXXXP---PPPXPPPXXXXXXXXXXGXRXXXPPX-----GGXXXP---PP 687 PPP P PPP PPP PP G P PP Sbjct: 439 PPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPP 498 Query: 688 PXXGAPPPXXPXXXXPPXXPPPXXXXGXXXXXXXXXXXXXXXXXXXXXXXXAGXPXPLPX 867 P AP P P PP +G P P+ Sbjct: 499 PSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTA 558 Query: 868 XXPPXPPXPSXP 903 P PP P Sbjct: 559 PPPAPPPSVFAP 570 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 33.5 bits (73), Expect = 0.25 Identities = 35/114 (30%), Positives = 36/114 (31%), Gaps = 6/114 (5%) Frame = +2 Query: 431 AAPXGXGGXGXXPXXXXXFXPPPXXGG--GXXGXPXXXPPP-PPXGGXGXXXXXPPPPXP 601 +AP G G P P G G G P PP PP G PP P Sbjct: 63 SAPRRGGYGGGPPRGPPRGHPMRGRGAPYGRGGPPSRGPPRGPPLPG-------PPRRGP 115 Query: 602 PPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXP---PPP 754 PP G PPP P PP G PPP P PPP Sbjct: 116 PPDRDSGYGGYGDRYDRPPPDR-RP-PPPDRSGYPPPRDYDRGYADRPRERPPP 167 >SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 33.5 bits (73), Expect = 0.25 Identities = 40/165 (24%), Positives = 41/165 (24%), Gaps = 7/165 (4%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGG---G 582 GG G G GGA GGG GG GGG GGG G Sbjct: 128 GGAATGTVLEVGTAVGGANTNGGGADNVAATGGGAVAGVGTADDGANTDGGGAGGGAVTG 187 Query: 581 XXXXXXXPPXGGGGGXXXXXXXPPPPPXGGXKKXKXXGGGXXS---PPXPXGXXXPGXAP 411 GGG P G GG + P G A Sbjct: 188 VGTPDDGANTDGGGAGGGSVTGVGTPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAA 247 Query: 410 XXXXXXXXFPPXXXGGGGGGXXKGXRRVTGG-XAAPXXRGXGXGG 279 P GGG G V G G G GG Sbjct: 248 GGAVTVVGSPDDGANTDGGGAAGGAVTVVGSPDDGANTDGGGAGG 292 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 605 GGGXGGGGXXXXXXXPPXGGGGGXXXXXXXPPP 507 GGG GGGG GGGGG PPP Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPP 505 G GGG GGGG GGGG PPP Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 767 PXXXXGGGXXGGXXXXGXXGGGAPXXGGGG 678 P G G GG G GGG GGGG Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGG 681 GGG GG G GGG GGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 749 GGXXGGXXXXGXXGGGAPXXGGGG 678 GG GG G GGG GGGG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_37501| Best HMM Match : SCP (HMM E-Value=1.2e-19) Length = 351 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -2 Query: 765 PRXXGGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTP 637 P+ GGGG G GGG P GG G P G G +P Sbjct: 14 PQAPGGGG-GSPTEAPGGGGGSPTEAPGGGGSTPTKGEGSTSP 55 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 33.5 bits (73), Expect = 0.25 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 1/72 (1%) Frame = +2 Query: 542 PPPPXGGXGXXXXXPPPPXPPPX-PXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 PPPP PPP P P G V PPPP PP PP Sbjct: 362 PPPPI------IPIPPPAMPAMFNPHVPPPMIGPVTVPPPPL----IPPPQASIPPPTMI 411 Query: 719 XXXXXPPXPPPP 754 P PPPP Sbjct: 412 QTLPPPSVPPPP 423 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 4/71 (5%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPP----XPXXXXXXX 634 P F PPP P P P G PPP PPP P Sbjct: 355 PNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTL 414 Query: 635 GGVXXPPPPXG 667 PPPP G Sbjct: 415 PPPSVPPPPIG 425 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPP 750 PP PPPP PPP P P PP Sbjct: 354 PPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPP 385 Score = 29.1 bits (62), Expect = 5.5 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = -2 Query: 747 GGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXX 568 GG GGG G GG G GG GGGG Sbjct: 2275 GGINPMNFGASAGGGLYSDGGASPGDFETGGKSFLNGGEGGESRAGPVGGFGGGGSSRIR 2334 Query: 567 PXPPXGGGGGXXXG 526 P GGGGG G Sbjct: 2335 P----GGGGGYSGG 2344 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.5 bits (73), Expect = 0.25 Identities = 21/84 (25%), Positives = 23/84 (27%) Frame = +1 Query: 352 PPPPPPXXXGGXXXXXXXXXGAXPGXXXPXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXX 531 PPPPPP + G + PPP P GG Sbjct: 849 PPPPPPVARKPSRSNSTSSQQSIESAPGSPPTGADDFPPPPPPPVMKKPSRGGSLKESRL 908 Query: 532 XXPPPPPXGGXXXXXXXPPPPXPP 603 P P G P PP PP Sbjct: 909 HPPLPSIHGSTDSLDSLPLPPPPP 932 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGG 654 GGG GG G GGG GGGG GG Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 675 GXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGG 538 G GGGG G GGG GGGG G GG Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 33.1 bits (72), Expect = 0.33 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 765 PRXXGGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 PR G G GGG GG G GGGG G GGG GGG Sbjct: 82 PRGERGAGGSRAGGYRSGGGGYGGSSRGGYGGG-RGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGGG GG GG GG G GGG GGG GGG Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGG---GYGGGRRDYGGGSKGGG 152 >SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 1321 Score = 32.7 bits (71), Expect = 0.44 Identities = 30/114 (26%), Positives = 31/114 (27%), Gaps = 3/114 (2%) Frame = +2 Query: 419 PRXXAAPXGXGGXGXXPXXXXXFXPPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPX 598 P + P G P PPP G P P PP G P Sbjct: 874 PPMSSQPQPPPGNQVNPPMSSQPQPPP---GNQVNPPMSSQPQPPPGNQ---VNPPMSSQ 927 Query: 599 PPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP---XXXXXXXPPXPPP 751 P P P P PP G PP PPP P PPP Sbjct: 928 PQPLPGNQVNPPMS-SQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 980 Score = 31.9 bits (69), Expect = 0.77 Identities = 27/101 (26%), Positives = 27/101 (26%), Gaps = 14/101 (13%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXP-----PPXPXXXXXXXGGVXXPP 655 P P G P PPP P P P PP G PP Sbjct: 896 PQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPLPGNQVNPPMSSQPQPPPGNQVNPP 955 Query: 656 ------PPXGGXPXPPXXXXGXPPP---XXXXXXXPPXPPP 751 PP G PP PPP P PPP Sbjct: 956 MSSQPQPPPGNQVNPPMSSQPQPPPGNQVNPPMSSQPQPPP 996 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 1/58 (1%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXG-GGGXXTPPXXXXXXXGXGGGXGGGG 583 GGGG GG GGG GG G G GG + G G G GG G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYG 818 Score = 28.3 bits (60), Expect = 9.5 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGG GG GGG GG G GGGG G G GG Sbjct: 756 GGGYRGGGGYG---GGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQ 812 Query: 573 XXPXPPXGGGG 541 G GG Sbjct: 813 GSGGYGQGSGG 823 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 32.7 bits (71), Expect = 0.44 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 7/64 (10%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXP--XPPXXXXGXPP-----PXXXXXXXPPX 742 P P P P GG P PP GG P PP G P P Sbjct: 582 PTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQH 641 Query: 743 PPPP 754 PPPP Sbjct: 642 PPPP 645 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 669 GXXPPPXXXGGXPPPXXXXXXXPXXPPPXXXXG 767 G PPP GG P P P PPP G Sbjct: 590 GTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPG 622 Score = 29.1 bits (62), Expect = 5.5 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXP 706 P PPP P GG P P PP GG PPP G P P Sbjct: 589 PGTYPPPHPSGGY-------PQPSPP---------HGGHPHHPPPTGYPGGYPGTHTAPP 632 Query: 707 PPXXXXXXXPPXPP 748 PP PP Sbjct: 633 AGGYPTGQHPPPPP 646 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +1 Query: 436 PXGXGGEXXPPPXXFXFFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPP 606 P G + PP PP G GG PP GG PPPP P Sbjct: 597 PSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTH---TAPPAGGYPTGQHPPPPPAGYP 650 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 658 PXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 P G PP P G P P P P PP G Sbjct: 587 PQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGG 623 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 32.3 bits (70), Expect = 0.59 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -2 Query: 762 RXXGGG-GXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 R GGG G G GG GG G GGG G GGG GG Sbjct: 133 RGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGG 192 Query: 585 G 583 G Sbjct: 193 G 193 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXG-GGXGGGGXX 577 GG GG GGG GG G G G G G GG GGG Sbjct: 122 GGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGR 181 Query: 576 XXXPXPPXGGGGGXXXG 526 GGGG G Sbjct: 182 GRGTGGGSRGGGGDGRG 198 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXP 613 PPPPP PP P PPP P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNP 30 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 587 PPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPP 709 PPP PPP P PPPP P P P Sbjct: 5 PPPPPPPPPIAAEFT--APPAPPPPPNPAPDVPAESVNTQP 43 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 PPPP PPP PP PPP Sbjct: 5 PPPPPP--PPPIAAEFTAPPAPPPP 27 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 32.3 bits (70), Expect = 0.59 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 4/74 (5%) Frame = -2 Query: 747 GGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGG----XGGGGX 580 G G GGG GG G GGGG + G GGG G GG Sbjct: 261 GKGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGA 320 Query: 579 XXXXPXPPXGGGGG 538 GG GG Sbjct: 321 AATGCTNQYGGSGG 334 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 G G GG GGG G GGGG + G GG G Sbjct: 277 GEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGSGGIA 336 Query: 573 XXPXPPXGGGGG 538 GGGG Sbjct: 337 SSTIGACAGGGG 348 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/72 (27%), Positives = 20/72 (27%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 G GG GGG G G GG G GGG G Sbjct: 331 GSGGIASSTIGACAGGGGSSNCQAGNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDY 390 Query: 573 XXPXPPXGGGGG 538 GGGGG Sbjct: 391 TSRLSYGGGGGG 402 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 587 PPPXPPPXPXXXXXXXGGVXXP-PPPXGGXPXPPXXXXGXPPP 712 PPP PPP P P PPP P PP PP Sbjct: 1124 PPPPPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPPPITINVPP 1166 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.9 bits (69), Expect = 0.77 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 635 GGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPPXXRG 766 G PPPP P PP PPP P P PP G Sbjct: 90 GTCGDPPPP--ATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGG 131 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 667 GXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 G PPP PPP P PP P P Sbjct: 90 GTCGDPPPPATPPPPTMPPTPPPPQTPAP 118 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 31.9 bits (69), Expect = 0.77 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 1/72 (1%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG-GXXX 574 GG GG GGG GG G GGG + G GG GGG G Sbjct: 152 GGYRGGYRGGRDRGGGYGGGGEGGYGM----GGGDYSGGCGYGSSYGGGGDYGGGPGYGG 207 Query: 573 XXPXPPXGGGGG 538 GGGG Sbjct: 208 GQGYGSYSGGGG 219 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -2 Query: 762 RXXGGGGXGGXXXXXXXGGGXPXXXXGGXG-XPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 R GGG GG GGG GG G GGGG G G GGG Sbjct: 162 RDRGGGYGGGGEGGYGMGGG---DYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGG 218 Query: 585 G 583 G Sbjct: 219 G 219 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 31.9 bits (69), Expect = 0.77 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = -2 Query: 744 GXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXP 565 G G GGG P G G P G G P GGG G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGD 384 Query: 564 XPPXGGGGGXXXG 526 GGG G Sbjct: 385 HGGGDHGGGDHGG 397 Score = 28.7 bits (61), Expect = 7.2 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -3 Query: 752 GGGXXG-GXXXXGXXGGGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGG 582 G G G G G GGG P G G P G GGG GGG Sbjct: 331 GDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGG 388 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXP 613 P P P PPPP PPP P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPP 387 Score = 25.8 bits (54), Expect(2) = 1.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 584 PPPPXPPPXP 613 PPPP PPP P Sbjct: 381 PPPPPPPPAP 390 Score = 24.2 bits (50), Expect(2) = 1.0 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPP 607 P P P PPPP PPP Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPP 387 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 31.5 bits (68), Expect = 1.0 Identities = 24/74 (32%), Positives = 24/74 (32%), Gaps = 3/74 (4%) Frame = -3 Query: 749 GGXXGGXXXXGXXG---GGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGX 579 GG GG G G GGA GG G GG R GGG G G Sbjct: 180 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGG 239 Query: 578 XXXXXXPPXGGGGG 537 GGG G Sbjct: 240 GGGGGGGYSGGGSG 253 Score = 29.5 bits (63), Expect = 4.1 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = -2 Query: 747 GGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXX 568 GG GG G P GG G GGGG G GGG GGG Sbjct: 213 GGVGGRSVW----NGVPGGFGGGGGVWGNGGGG------------GGGGGYSGGGSGNPH 256 Query: 567 PXPPXGGGGGXXXG 526 GGGG G Sbjct: 257 YYACGGGGGSYNSG 270 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXP 747 PPPP GAPPP PP P Sbjct: 218 PPPPTTGAPPPTPVTNKPPPPRP 240 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PPPP G P P PPP PP P Sbjct: 218 PPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 >SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) Length = 723 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGG-GXPXXXXGGXGX-PPXGGGGXXTPPXXXXXXXGXGGGXG 592 G GG GG GG G P GG G P G GG G GGG G Sbjct: 367 GLGGYGGFLGHAGFGGWGFPGGFLGGYGGYAPLGWGGYGYDAWGHPGGWGWGGGCG 422 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.5 bits (68), Expect = 1.0 Identities = 26/74 (35%), Positives = 26/74 (35%), Gaps = 3/74 (4%) Frame = -3 Query: 749 GGXXGGXXXXGXXG---GGAPXXGGGGXXXPPXGGXXXRXPXXXXXXXXXXGGGXGGGGX 579 GG GG G G GGA GG G GG R GGG GGG Sbjct: 441 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGG 500 Query: 578 XXXXXXPPXGGGGG 537 GGGGG Sbjct: 501 G-------GGGGGG 507 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 667 GXXXPPPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 G PPP PPP P PP PP G Sbjct: 426 GTATPPPTPPPTPPPTPPPTTLPPTTQPPPQPTG 459 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.5 bits (68), Expect = 1.0 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = +2 Query: 521 GXPXXXPPPPPXGGXGXXXXXPP--PPXP--PPXPXXXXXXXGGVXXPPPPXGGXPXPPX 688 G P PP G G P PP P PP P G PPP GG P P Sbjct: 380 GFPPRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRG----PPPHGGPPRGPM 435 Query: 689 XXXGXPPP 712 PP Sbjct: 436 GPGPGMPP 443 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 491 PPPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 P P G G P PPP GG P P PP P Sbjct: 406 PRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMRP 446 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 6/62 (9%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPP------PPXGGXPXPPXXXXGXPPPXXXXXXXPPXP 745 PPPP P P G P PP GG P P PP P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQP 177 Query: 746 PP 751 PP Sbjct: 178 PP 179 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXP 652 P PPPPP PPPP PPP GG P Sbjct: 864 PRRPPPPPPP------PPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXPP 932 P PP P PPPP P PP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 682 PPPXXGAPPPXXPXXXXPPXXPPPXXXXG 768 P P PPP P PP PPP G Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTG 890 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 682 PPPXXGAPPPXXPXXXXPPXXPPP 753 P P PPP P PP PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 679 PPPPXXGAPPPXXPXXXXPPXXPPP 753 P P PPP P PP PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 850 PXPLPXXXPPXPPXPSXPP 906 P P P PP PP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPP 878 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 P PPPP PPPP PPP P Sbjct: 862 PRPRRPPPP-----PPPPPPPPPPPPPPP 885 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 31.1 bits (67), Expect = 1.4 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 10/95 (10%) Frame = -2 Query: 762 RXXGGGGXGGXXXXXXXG--GGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGX-- 595 R GGG G G GG P GG G GGG G GGG Sbjct: 423 RGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQ----GGGYEGYSGGYRDDYGYGGGSYD 478 Query: 594 ------GGGGXXXXXPXPPXGGGGGXXXGXPXXPP 508 GGG PP GG G G PP Sbjct: 479 HYDSYYGGGYDDYYGGGPPRGGPRGGRGGSRGGPP 513 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXP 720 PP G PPPP GAPPP P Sbjct: 197 PPPSGA--PPPPPIGAPPPPPP 216 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGG 678 GGG GG G GGG GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGG 538 G GGG GGGG GGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 606 GGGXGGGGXXXXXPXPPXGGGGGXXXG 526 GGG GGGG GGGGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 GG GG GGG GG G GGG G GGG GGG Sbjct: 132 GGMGGGMSMGGGMGGGMSMGGMGG-GMGGMMGGGSMGGGMMSMAGGGMGGGMGGG 185 Score = 29.9 bits (64), Expect = 3.1 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXX 571 GGG GG GGG GG G GG G G GG GGG Sbjct: 154 GGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMG-----------GGMEGGMGGGMMEGM 202 Query: 570 XPXPPXGGG--GGXXXG 526 GGG GG G Sbjct: 203 QGMGSMGGGMMGGGMGG 219 Score = 29.1 bits (62), Expect = 5.5 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 1/89 (1%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GG GG GG GG G GGG G GG GGG Sbjct: 114 GGPSEGGLMQKQFIEGGE-----GGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGG 168 Query: 573 XXPXPPXGG-GGGXXXGXPXXPPPXXGGG 490 GG GGG G GGG Sbjct: 169 GMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 30.7 bits (66), Expect = 1.8 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGGG G GGG GG G G GG G G GGGG Sbjct: 122 GGGGQAGGQAGSQAGGGAA----GGGGQEGGGQGGAQAGGSTSGSSSG-GATSGGGGVSG 176 Query: 573 XXPXPPXGGGGGXXXG 526 GGG G Sbjct: 177 SSGTSIAGGGSSAGAG 192 Score = 29.5 bits (63), Expect = 4.1 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGG-XGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXX 577 GGG GG GGG G G GGGG G GG GG Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGG--------QEGGGQGGAQAGGSTS 160 Query: 576 XXXPXPPXGGGGG 538 GGGG Sbjct: 161 GSSSGGATSGGGG 173 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG G GGG G GGG Sbjct: 444 GDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGGXXXPPXGG 654 GGG GG G GGG GGG GG Sbjct: 452 GGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 GGG G G G G GGG G GGG GGG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 P PPPPP PPPP PPP P Sbjct: 1307 PPESPPPPPP--------PPPPPPPPPLP 1327 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 882 PPXPLXPPPPXPXXXPP 932 PP P PPPP P PP Sbjct: 1312 PPPPPPPPPPPPPPLPP 1328 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 1311 PPPPPPPPPPPPPPPLPP 1328 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPP 607 PPPPP PPPP PP Sbjct: 84 PPPPPPPASNVPAPPPPPPVMPP 106 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 521 GXPXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 G PPPPP PPPP P P Sbjct: 76 GPAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 711 GGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGG GG G GG G GGG GGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXP 613 PPPPP PPPP PPP P Sbjct: 424 PPPPPP-----PAPLPPPPPPPPQP 443 Score = 29.5 bits (63), Expect = 4.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 876 PXPPXPLXPPPPXP 917 P PP PL PPPP P Sbjct: 427 PPPPAPLPPPPPPP 440 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/79 (26%), Positives = 22/79 (27%), Gaps = 3/79 (3%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPP--XPXXXXXXXGGVXXPPPPXG-GXPXPPXXXX 697 P PPPP P PP PPP + PPPP P P Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPP 740 Query: 698 GXPPPXXXXXXXPPXPPPP 754 P PP P Sbjct: 741 SSKHPPTVSPSSSSAPPRP 759 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 656 PPXGGXPXPPXXXXGXPPPXXXXXXXP-PXPPPPXXRG 766 PP G P P G PP P P PPPP G Sbjct: 217 PPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGG 254 Score = 28.3 bits (60), Expect = 9.5 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 PP P G PPP PP G+ PPP G P PP G PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQ----GLPFPPP--GPIP-PPPGAGGMRPPHG 260 Query: 719 XXXXXPPXP 745 P P Sbjct: 261 QMHMGGPRP 269 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/76 (26%), Positives = 21/76 (27%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 G G G G G G G G + G GG GGG Sbjct: 135 GDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGG 194 Query: 573 XXPXPPXGGGGGXXXG 526 GGGGG G Sbjct: 195 GDDGGSDGGGGGNDGG 210 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 542 PPPPXGGXGXXXXXPPPPXPP 604 PPPP G PPPP PP Sbjct: 64 PPPPPPRRGFYDDYPPPPPPP 84 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXP--LXXGAAXPPVTRRXPFXXPPPPPP 369 P+ E PP P P PP RR + PPPPP Sbjct: 40 PRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPP 82 Score = 24.2 bits (50), Expect(2) = 6.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 262 SPNXSXPPXPXPLXXGAAX-PPVTRRXPFXXPPPPPP 369 S N PP P P P T PPPPPP Sbjct: 19 SNNLLRPPPPPPTRPFERNIHPRTEPRDRERPPPPPP 55 Score = 23.0 bits (47), Expect(2) = 6.0 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +1 Query: 454 EXXPPPXXFXFFX----PPXGGGGGXXXXXXXPPPPP 552 E PPP F+ PP G PPPPP Sbjct: 48 ERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 512 GXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXG 667 G G P PP G PP P PP G PP P G Sbjct: 3785 GVPGRPSTIAGPPGPPGRSKNISGPPGPQGPPGQASQIPGPPGPQGPPGPPG 3836 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGGG GG GGG G G G G G G G G Sbjct: 322 GGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDG 378 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPP 604 P PPPPP G PPPP PP Sbjct: 785 PPEYPPPPP----GLARPNPPPPNPP 806 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +2 Query: 449 GGXGXXPXXXXXFXPPPXXGGGXX--GXPXXXPPPPPXGGXGXXXXXPPPPXP 601 G G P PPP G G P P P G PPPP P Sbjct: 42 GQFGMFPGWPQMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXP----PPXXXXXXXPPXPPPP 754 PPPP G P P P P PP PPPP Sbjct: 56 PPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXP 613 P PP P PPPP PPP P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPPPPP 368 Score = 26.6 bits (56), Expect(2) = 4.5 Identities = 12/38 (31%), Positives = 12/38 (31%) Frame = +1 Query: 493 PPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPP 606 PP PP P PPPP PPP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPP 367 Score = 21.0 bits (42), Expect(2) = 4.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 Query: 682 PPPXXGAPPPXXP 720 PPP PPP P Sbjct: 359 PPPPPPPPPPTPP 371 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = +2 Query: 494 PPXXGGGXXGXPXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGX 673 PP GGG P P PPP P PP P P GG Sbjct: 423 PP--GGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTIATSGPPGGA 480 Query: 674 PXPPXXXXGXPP 709 P P G PP Sbjct: 481 PSP---MGGGPP 489 Score = 28.7 bits (61), Expect = 7.2 Identities = 21/77 (27%), Positives = 22/77 (28%), Gaps = 2/77 (2%) Frame = +1 Query: 241 TAPQKERSPNXSXP--PXPXPLXXGAAXPPVTRRXPFXXPPPPPPXXXGGXXXXXXXXXG 414 T K P P P P P + PP T P P PP P G Sbjct: 416 TCTAKGGPPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPPTTMTTILTTIATSG 475 Query: 415 AXPGXXXPXGXGGEXXP 465 G P G G P Sbjct: 476 PPGGAPSPMGGGPPGGP 492 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PPXGGXXXPPPPXXGAPPPXXPXXXXPPXXPPP 753 PP GG PPP PP P PP P P Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIP----PPTTPLP 451 >SB_28593| Best HMM Match : CUB (HMM E-Value=1.3e-14) Length = 327 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 542 PPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPP 685 PPP G PPP P P GG P P G P PP Sbjct: 268 PPPVAVQQGQPLVVPPPGSYPTQPQTGYPAQGG--YPMQPQGQMPPPP 313 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.9 bits (64), Expect = 3.1 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = -2 Query: 708 GGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXX 529 GG GG GG G G GGG GGG GGGGG Sbjct: 208 GGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTH--SGQAGGGGGSYC 265 Query: 528 GXPXXPPPXXGGGKK 484 G G K+ Sbjct: 266 GGSSCSAVTGGNSKE 280 >SB_14127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1185 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 599 PPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPP 712 PPP P G + PP P P G PPP Sbjct: 385 PPPLPPRRSMIIGPISTPPMDGVDAPASPASPEGTPPP 422 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 24.2 bits (50), Expect(2) = 4.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 441 GGGGGXXPXPXPLXFFXPPP 500 GGG G P P P PPP Sbjct: 164 GGGEGPNPSPPPSGAPPPPP 183 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 585 PPPPPPP 605 PPPPPPP Sbjct: 179 PPPPPPP 185 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 29.5 bits (63), Expect = 4.1 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 3/92 (3%) Frame = -2 Query: 753 GGGGX--GGXXXXXXXGGGXPXXXXGGXGXPPX-GGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGGG GG GGG G G GGGG G G GG Sbjct: 558 GGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDGDYNGGDGDYNGGDGDYNGGD 617 Query: 582 XXXXXPXPPXGGGGGXXXGXPXXPPPXXGGGK 487 GG G G GG K Sbjct: 618 DDYNGGDGDSNGGDGGDNGTGDGDGDYNGGDK 649 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGG 538 G GGG GGGG GGGGG Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGGG 127 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 548 PPXGGXGXXXXXPPPPXPPPXP 613 P G G PPPP PPP P Sbjct: 784 PEGEGVGGITPPPPPPPPPPPP 805 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 P PP P P + PPP P PP P P PP PP P Sbjct: 115 PTPPFSTPRPRPKAKRIRRLLPTPPP----PTPPQ---STPKPRRVLPTPPPKPPTP 164 >SB_17315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = -1 Query: 514 PPPXPGG-GXKXXXGXGXGXXPPPPPGGXXXPG 419 PP GG G G G PP PPG PG Sbjct: 29 PPGLAGGVGANGPSGRGGSQGPPGPPGAPGQPG 61 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +2 Query: 539 PPP---PPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPP 685 PPP PP PP P P P V PP P G P PP Sbjct: 2603 PPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 25.8 bits (54), Expect(2) = 4.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 584 PPPPXPPPXP 613 PPPP PPP P Sbjct: 142 PPPPPPPPSP 151 Score = 21.8 bits (44), Expect(2) = 4.5 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 Query: 650 PPPPXGGXPXPPXXXXGXP 706 PPPP P PP P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.1 bits (62), Expect = 5.5 Identities = 29/112 (25%), Positives = 31/112 (27%), Gaps = 16/112 (14%) Frame = +2 Query: 467 PXXXXXFXPPPXXGGGXXGXPXXX--PP----PPPXGGXGXXXXXPPP-PXPPPXPXXXX 625 P + PPP G P PP PPP PPP PPP Sbjct: 276 PGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPPPQQFDYQ 335 Query: 626 XXXGGVXXPPPPXGGXPXPPXXXXG---------XPPPXXXXXXXPPXPPPP 754 + PPP PP G P PP PPP Sbjct: 336 HGRANMDIPPPIDYNHGRPPHDDFGHEAYGPDDYGPDSYGPEEFGPPPVPPP 387 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.1 bits (62), Expect = 5.5 Identities = 27/91 (29%), Positives = 27/91 (29%), Gaps = 3/91 (3%) Frame = -2 Query: 753 GGGGXG---GXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGG 583 GGGG G GG GG G GG G GGG G G Sbjct: 422 GGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQ-NDVEGGFGGGGGPNGAG 480 Query: 582 XXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GGGGG G GGG Sbjct: 481 GG-------GGGGGGYSGGASGSRSNSCGGG 504 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXG 592 GGGG G GGG G GGGG G G G Sbjct: 472 GGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAGSDKSQQAGANNGAG 525 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPPP PPP P PPPP GG Sbjct: 68 PPPPPPPPPP----------LPPPPPSGG 86 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGG 670 PPPP PPP P PPPP GG Sbjct: 292 PPPPPPPPPP----------LPPPPPSGG 310 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 606 GGGXGGGGXXXXXPXPPXGGGGGXXXG 526 GGG GGG P GGGGG G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGG 52 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 752 GGGXXGGXXXXGXXGGGAPXXGGGG 678 GGG GG G GG GGGG Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGG 50 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.1 bits (62), Expect = 5.5 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -2 Query: 753 GGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXX 574 GGG GG GGG GG G GGG G GGG G GG Sbjct: 184 GGGSQGGGYRSG--GGGYGGSSRGGYGGGRGGGG----------YGGGRGGGGGYGGGRR 231 Query: 573 XXPXPPXGGG 544 GGG Sbjct: 232 DYGGGSKGGG 241 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 612 GXGGGXGGGGXXXXXPXPPXGGGGGXXXGXPXXPPPXXGGG 490 G GGG GGGG GGGGG G GGG Sbjct: 206 GYGGGRGGGGYGGGR-----GGGGGYGGGRRDYGGGSKGGG 241 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +2 Query: 584 PPPPXP-PPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPP---XPPP 751 P PP P PP P G P PP P P PP P PPP Sbjct: 20 PKPPQPTPPKPDTPPP---GTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPP 76 Query: 752 P 754 P Sbjct: 77 P 77 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 905 GGXEGXGGXGGXXXGRGXGXP 843 GG G GG GG GRG G P Sbjct: 518 GGGGGGGGGGGGRGGRGRGRP 538 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 527 PXXXPPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPP 661 P PPPP PPP PPP + PPPP Sbjct: 194 PEPTRPPPPLDDLDDL----PPPPPPPPEDDSIHNHEDLPPPPPP 234 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 144 KEKKXXKKXKKKKNKKXXK 200 K+KK KK KKKKNKK K Sbjct: 26 KKKKKKKKKKKKKNKKNKK 44 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 602 PPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXXXXXXXPPXPPPP 754 PP P P P P P PPP PP PPP Sbjct: 227 PPEPEDYNKLEEWTGDKPHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 >SB_20903| Best HMM Match : Extensin_2 (HMM E-Value=0.3) Length = 713 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 591 PPPPPXXXXXXXXXXGXSXXXPPRGGGXXPPPXXXGGXPPPXXXXXXXPXXPP 749 PPPPP S PP GG PP G PP PP Sbjct: 487 PPPPPPSDAMMQGMGAPSMSEPPAGG----PPMGQGPPRPPTNPTAAPMGQPP 535 >SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) Length = 327 Score = 28.7 bits (61), Expect = 7.2 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 708 GGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXX 529 GG G G G G G GGG GGG GGGG Sbjct: 241 GGSAYVNGGEGGLGTTGSEGGFGGGGAAFLYAGGGGGYSGGGVTRATRYSKSGGGGSYNA 300 Query: 528 G 526 G Sbjct: 301 G 301 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 682 PPPXXGAPPPXXPXXXXPPXXPPP 753 PPP PPP P PP PPP Sbjct: 73 PPPLCAPPPPPPP---PPPPPPPP 93 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 28.7 bits (61), Expect = 7.2 Identities = 37/158 (23%), Positives = 38/158 (24%), Gaps = 6/158 (3%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPV---TRRXPFXXPPPPPPXXXGGXXXXXXXXXGAX--PGXXXPXG 444 P P L G PP R P PP G G P P Sbjct: 230 PGPPALLQQGPPGPPFHGEPRPPPHHDMRGPPDQWVPGPEQRRDNMRGPGMPPDMHGPPD 289 Query: 445 XGGEXXPPPXXFX-FFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPPXXXXX 621 G PP F PP G G P P G P PP Sbjct: 290 RGRHDRGPPHDHRDFHGPPDGPHGQRMQHHDIRGPDPRGDRG-------PRGPPSGVPTS 342 Query: 622 XXXXXGXRXXXPPXGGXXXPPPPXXGAPPPXXPXXXXP 735 G + P PP P PP P P Sbjct: 343 GGPPPGHQGLRPSGPNNQGPPGPGPNMPPVSGPSNPAP 380 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 584 PPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPP 685 PPPP PPP P PPPP P P Sbjct: 54 PPPPPPPPPPP---------PPPPPPPSSSPSRP 78 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 882 PPXPLXPPPPXPXXXPP 932 PP P PPPP P PP Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 882 PPXPLXPPPPXPXXXPP 932 PP P PPPP P PP Sbjct: 55 PPPPPPPPPPPPPPPPP 71 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 876 PXPPXPLXPPPPXPXXXP 929 P PP P PPPP P P Sbjct: 58 PPPPPPPPPPPPPPSSSP 75 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 250 QKERSPNXSXPPXPXPLXXGAAXPPVTRRXPF 345 Q +SPN P P PL A PP T PF Sbjct: 301 QASKSPNYDIEPIPVPLNSSA--PPPTEEAPF 330 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 682 PPPXXGAPPPXXPXXXXPPXXPPP 753 PPP PPP P PP PPP Sbjct: 274 PPPLCAPPPPPPP---PPPPPPPP 294 >SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2142 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 637 GXRXXXPPXGGXXXPPPPXXGAPPPXXP 720 G R PP PPPP APP P Sbjct: 1421 GSRHQPPPSVDMSQPPPPAFAAPPQHLP 1448 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 28.7 bits (61), Expect = 7.2 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -2 Query: 684 GGXGXPPXG---GGGXXTPPXXXXXXXGXGGGXGGGGXXXXXPXPPXGGGGGXXXG 526 G G P G GGG P G GGG GGGG GGG G G Sbjct: 33 GRPGFSPRGAGRGGGRGGP-----RGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 711 GGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXG 592 GGG GG G GGGG P G GGG G Sbjct: 45 GGGRGGPRGGGRGGG-RGGGGGFKSPRGGGRGGGRGGGRG 83 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPX--PPPXP 613 PPPPP PPPP PPP P Sbjct: 81 PPPPPIYMPPPPVYMPPPPVYMPPPMP 107 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 28.3 bits (60), Expect = 9.5 Identities = 24/87 (27%), Positives = 24/87 (27%) Frame = -2 Query: 750 GGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGGGXXXX 571 GG GG GGG GG GGG G GG G Sbjct: 335 GGDAGGSMQGLAGGGGIQSFGGGGGADLQTLGGGGGVQTLGGQTMQGVQSYGGGAGMQSF 394 Query: 570 XPXPPXGGGGGXXXGXPXXPPPXXGGG 490 GG G G P GGG Sbjct: 395 G----GGGMAGMQFGGMQGFPSLGGGG 417 >SB_41909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 484 FFXPPXGGGGGXXXXXXXPPPPPXGGXXXXXXXPPPPXPPP 606 FF PP GG G P P G PPP P Sbjct: 91 FFGPPSDGGFGPSDRGSPVPRPSCGSSFFSERDPPPGKGSP 131 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 280 PPXPXPLXXGAAXPPVTRRXPFXXPPPPPP 369 PP P + G PP P PPPPPP Sbjct: 115 PPAPTSVPSGPRAPP---GGPGAPPPPPPP 141 >SB_55225| Best HMM Match : efhand (HMM E-Value=5.7e-12) Length = 828 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 411 GXXPGXXXPPGGGGGXXPXPXPLXFFXPPPGXGGG 515 G PG PPG G G P + PPG G G Sbjct: 562 GYGPGYTNPPGYGPGYTNTPGYGPGYTNPPGYGPG 596 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +1 Query: 247 PQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPFXXPPP--PPP 369 P P P P PL PP T P P P PPP Sbjct: 46 PATALCPTPCYGPVPHPLLRPCVPPPATALVPHPLPRPCAPPP 88 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 241 TAPQKERSPNXSXPPXPXPLXXGAAXPPVTRRXPF---XXPPPPPP 369 T + SP+ P P P+ + PP R P PPPPP Sbjct: 845 TKTDRPLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPP 890 Score = 28.3 bits (60), Expect = 9.5 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = +2 Query: 539 PPPPPXGGXGXXXXXPPPPXPPPXPXXXXXXXGGVXXPPPPXGGXPXPPXXXXGXPPPXX 718 PPP P G PP P P P PPPP P Sbjct: 856 PPPLPPRPVGAPPSLPPRPRTRPLPPKSD------TPPPPPRPAADESQEMSRTRGP--- 906 Query: 719 XXXXXPPXPPPP 754 PP PPPP Sbjct: 907 KDGRKPPPPPPP 918 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 28.3 bits (60), Expect = 9.5 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 765 PRXXGGGGXGGXXXXXXXGGGXPXXXXGGXGXPPXGGGGXXTPPXXXXXXXGXGGGXGGG 586 PR GGG GGG GG G GGG G GG GGG Sbjct: 87 PRGERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGG--------YGGGRGGGGSYGGG 138 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 25.8 bits (54), Expect(2) = 9.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 584 PPPPXPPPXP 613 PPPP PPP P Sbjct: 818 PPPPPPPPPP 827 Score = 20.6 bits (41), Expect(2) = 9.6 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 734 PPXPPPP 754 PP PPPP Sbjct: 822 PPPPPPP 828 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,876,147 Number of Sequences: 59808 Number of extensions: 773773 Number of successful extensions: 17023 Number of sequences better than 10.0: 154 Number of HSP's better than 10.0 without gapping: 1074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6080 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2752873431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -