BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B19 (844 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0076 - 622789-623689,623714-623931 30 2.0 12_02_0580 + 20776820-20777247,20777341-20778109,20779280-207794... 29 3.5 09_02_0393 + 8510089-8510274,8510450-8510806,8510889-8511011,851... 29 3.5 >06_01_0076 - 622789-623689,623714-623931 Length = 372 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +2 Query: 422 PWAVVEP---LLLVLNLGTHGFYPFPGTFR 502 PW V+ L+L L++G H Y FPGTF+ Sbjct: 233 PWLVISGDMLLMLDLSVGIHHSYGFPGTFQ 262 >12_02_0580 + 20776820-20777247,20777341-20778109,20779280-20779447, 20779877-20780236 Length = 574 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 252 RTIVRTFPIERTARNSPHTPTIIVLLLIVYT 160 R VR P E T ++ PH PT+ L L V T Sbjct: 394 RLTVRVLPAEDTVKDIPHLPTVTKLRLDVNT 424 >09_02_0393 + 8510089-8510274,8510450-8510806,8510889-8511011, 8511209-8511523,8511576-8511682,8512559-8512629, 8512952-8513029,8513390-8513454,8514224-8514274, 8514373-8514414,8514785-8515105,8515154-8517880 Length = 1480 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 159 LYIQSTIKLLLWVCVVNCVQ-FFQLETFSQWFYTSLACAVESNYALYV 299 L QS + L CV N ++ FFQ+ SQW+Y C + S + Y+ Sbjct: 1031 LSFQSKWRTYLRSCVRNNLRTFFQVLVQSQWWYNLEGCLLHSPHLKYL 1078 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,125,248 Number of Sequences: 37544 Number of extensions: 516471 Number of successful extensions: 1099 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1099 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -