BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B18 (908 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1574 + 38337669-38338196 32 0.72 02_05_0410 + 28744716-28744841,28745361-28745965,28746151-287462... 29 6.7 >01_06_1574 + 38337669-38338196 Length = 175 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -2 Query: 670 AESVCHVSLYHLRNWRINSPGARSSRGANYGLISRCLCHFC 548 A S+C YH+R R + +G Y CLC C Sbjct: 37 AHSLCPYKFYHIRCLRYEQIASSEQQGNEYWYCPSCLCRVC 77 >02_05_0410 + 28744716-28744841,28745361-28745965,28746151-28746270, 28746597-28746737,28748626-28749370 Length = 578 Score = 28.7 bits (61), Expect = 6.7 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -1 Query: 230 DKGMRLRRRTRNCKPVLGNIGSRESTNRQNQ 138 +K +R++ + RNC+PV ++ +R+NQ Sbjct: 257 NKAVRIKIKERNCEPVFDLFRQKQQKSRKNQ 287 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,149,112 Number of Sequences: 37544 Number of extensions: 409871 Number of successful extensions: 826 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 826 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2577242800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -