BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B18 (908 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003151-1|AAK18921.2| 1184|Caenorhabditis elegans Hypothetical ... 30 2.6 Z68131-1|CAA92217.1| 467|Caenorhabditis elegans Hypothetical pr... 29 3.5 >AF003151-1|AAK18921.2| 1184|Caenorhabditis elegans Hypothetical protein D1007.15 protein. Length = 1184 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +1 Query: 190 LQFRVLRLKRIPLSTQRTKYVVNIYVFGLYCDHSAGF 300 L+F RL ++ LST+ ++++ + + +YC S+ F Sbjct: 1053 LEFNETRLGQVSLSTETIRHIIGLQITVIYCVLSSSF 1089 >Z68131-1|CAA92217.1| 467|Caenorhabditis elegans Hypothetical protein B0395.2 protein. Length = 467 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +2 Query: 566 SGNKPIICAPTTPCAWTVYSPVSKMIQTNMTNRFCICSXDTTCAITEDDTEVHAYI 733 + N P + A T A Y P+ + ++++ C CS TC T +VH++I Sbjct: 134 ASNLPFVTAYVTYLAAFFYFPLKFLYESDLK---CACSFIITCETTRIAMKVHSFI 186 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,237,997 Number of Sequences: 27780 Number of extensions: 362158 Number of successful extensions: 799 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2318293978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -