BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B17 (895 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 39 0.006 07_03_1136 + 24218601-24218734,24218769-24219906 36 0.057 02_05_0686 - 30900748-30902167,30903442-30904742 36 0.057 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 35 0.10 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 35 0.10 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 35 0.10 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 33 0.23 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.31 04_01_0197 + 2323790-2324098,2324145-2324774 33 0.31 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 33 0.31 01_06_1377 + 36764461-36765339 33 0.31 07_01_0080 + 587674-588510 33 0.40 12_02_1174 - 26696869-26698191 32 0.54 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 32 0.54 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 32 0.54 09_02_0327 - 7284829-7284889,7284946-7286126 32 0.54 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 32 0.54 03_01_0515 - 3864796-3865425 32 0.54 11_06_0610 - 25449085-25453284 32 0.71 03_02_0719 + 10654842-10654977,10655039-10655124,10655226-106570... 32 0.71 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 32 0.71 11_01_0621 - 4981070-4981136,4982906-4983825 31 0.94 05_01_0380 + 2978256-2979284 31 0.94 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 31 0.94 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 31 0.94 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 28 1.1 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 31 1.2 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 31 1.2 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 31 1.2 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 31 1.2 09_02_0603 - 11150739-11150746,11150791-11151340 31 1.2 08_02_1256 + 25645085-25645396 31 1.2 08_02_0796 - 21300251-21300373,21300846-21301721 31 1.2 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.2 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 31 1.2 07_03_0154 + 14509979-14512033 31 1.2 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 31 1.2 04_04_1687 - 35365766-35366356,35367137-35368135 31 1.2 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 31 1.2 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 31 1.2 04_01_0354 - 4646826-4647314 31 1.2 03_06_0599 + 34984869-34985319,34986581-34987563 31 1.2 03_03_0278 - 16126803-16129049 31 1.2 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.2 02_03_0279 + 17250347-17252098 31 1.2 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 31 1.2 07_03_0600 + 19866757-19867218,19867920-19868429 31 1.6 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 29 2.0 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 30 2.2 02_01_0091 + 646299-649082 30 2.2 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 30 2.2 01_03_0005 + 11568545-11569119,11569179-11569191 30 2.2 03_05_0067 - 20460206-20460703,20461255-20461530 25 2.2 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 30 2.9 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 30 2.9 01_01_0796 + 6190931-6192745 30 2.9 12_02_0848 + 23636478-23638058 29 3.8 10_08_0216 - 15942379-15942852,15942956-15943033 29 3.8 09_02_0543 + 10427321-10428315,10428440-10429154 29 3.8 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 29 3.8 06_03_0696 + 23617687-23617851,23618838-23619536 29 3.8 05_06_0063 + 25289117-25290643 29 3.8 03_06_0301 - 32974276-32974638,32974842-32974967,32975056-329751... 29 3.8 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 29 3.8 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 29 3.8 02_04_0382 - 22501041-22501279,22501717-22501810 29 3.8 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 3.8 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 3.8 12_02_0326 + 17555731-17556387 29 5.0 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 29 5.0 09_04_0365 - 16962608-16963174,16963301-16963486,16963824-169638... 29 5.0 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 5.0 08_01_0059 - 394001-394708 29 5.0 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 29 5.0 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 29 5.0 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 5.0 10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 29 6.6 09_03_0145 - 12749288-12751510 29 6.6 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 29 6.6 07_01_0479 + 3606663-3607448 29 6.6 04_04_1351 - 32827136-32827984 29 6.6 03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 29 6.6 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 29 6.6 01_05_0490 + 22672241-22674679 29 6.6 12_02_1070 - 25814741-25815850 28 8.7 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 28 8.7 12_01_0495 - 3935395-3937110 28 8.7 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 28 8.7 11_06_0016 - 19284810-19284926,19285527-19286879 28 8.7 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 28 8.7 08_01_0060 - 413088-413999 28 8.7 07_03_1771 - 29404972-29405175,29405282-29405677 28 8.7 07_03_1636 + 28290642-28291574 28 8.7 07_01_0753 - 5799733-5799741,5799938-5800642 28 8.7 07_01_0516 - 3850252-3852870 28 8.7 07_01_0052 - 411927-412589 28 8.7 06_01_0561 - 3983308-3983564,3983652-3983775 28 8.7 05_07_0031 - 27183252-27183317,27183542-27184282 28 8.7 05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605,518... 28 8.7 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 28 8.7 05_01_0141 - 937428-937717,938483-938705 28 8.7 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 28 8.7 04_04_0746 + 27726736-27727118,27727518-27727544,27728042-277281... 28 8.7 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 28 8.7 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 28 8.7 03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294... 28 8.7 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 28 8.7 03_02_0738 - 10824121-10825572 28 8.7 03_01_0593 + 4379263-4379377,4380359-4380491,4380585-4380656,438... 28 8.7 02_01_0148 - 1051121-1051192,1051378-1051512,1052343-1052396,105... 28 8.7 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 28 8.7 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 28 8.7 01_01_0046 - 331758-332627 28 8.7 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/84 (30%), Positives = 29/84 (34%) Frame = +1 Query: 538 PPXXXXXKXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFXFF 717 PP PPP G PP + P F PP G P P + F Sbjct: 22 PPPMNPYGPPPPQQPAYGHMPPPQGAPP---PFLAPPPPPPPGPPPPHQPQ-------FN 71 Query: 718 FFXXPXXXKNXPPPPPXXXPPPPP 789 F P + PPPP PPPP Sbjct: 72 FGPGPPQQQQPPPPPQMYYQPPPP 95 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPPXXFF 868 PP PPPP G PPPP + F G G ++++ PPPP ++ Sbjct: 48 PPPFLAPPPPPPPG--PPPPHQPQFNF--GPGPPQQQQPPPPPQMYY 90 Score = 30.7 bits (66), Expect = 1.6 Identities = 25/88 (28%), Positives = 28/88 (31%), Gaps = 3/88 (3%) Frame = +1 Query: 535 APPXXXXXKXPPPXX---GFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKX 705 APP PPP FG G P + P + PP P P + Sbjct: 53 APPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPP------PPPPYGVNSSQP 106 Query: 706 FXFFFFXXPXXXKNXPPPPPXXXPPPPP 789 P P PPP PPPPP Sbjct: 107 --------PPPPPPPPSPPPSAPPPPPP 126 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 35.5 bits (78), Expect = 0.057 Identities = 23/71 (32%), Positives = 24/71 (33%) Frame = -3 Query: 692 PXXXXGXGXPPPXFXGGXXXXXXKXGXXFXGGXPPPKPXXGGGXFXXKXXGGAPQXXFXX 513 P G G PP GG G GG PP P GGG GGAP+ Sbjct: 98 PGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGG-------GGAPRRVLGG 150 Query: 512 XPPXGVFXXPP 480 G PP Sbjct: 151 GGGGGALARPP 161 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 35.5 bits (78), Expect = 0.057 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXKK 798 P K PPPPP PPPPP K Sbjct: 338 PPPPKGPPPPPPAKGPPPPPPPK 360 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXKK 798 P K PPPPP PPPPP K Sbjct: 329 PPPPKAAPPPPPPKGPPPPPPAK 351 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 PP K PPPP PPPP K K PPPP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGP--PPPPPPKGPSPPPPP 368 Score = 32.7 bits (71), Expect = 0.40 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP PPPPP K Sbjct: 328 PPPPPKAAPPPPPPK 342 Score = 29.9 bits (64), Expect = 2.9 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +1 Query: 565 PPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFXFFFFXXPXXXK 744 PPP PP P PP G P P G P Sbjct: 315 PPPPPKPAAAAPPPPPPPK-----AAPPPPPPKGPPPPPPAKGPPPP------PPPKGPS 363 Query: 745 NXPPPPPXXX---PPPPPXK 795 PPPPP PPPPP K Sbjct: 364 PPPPPPPGGKKGGPPPPPPK 383 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PPPP K Sbjct: 327 PPPPPPKAAPPPPPPK 342 Score = 28.3 bits (60), Expect = 8.7 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +1 Query: 535 APPXXXXXKXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFXF 714 A P P P PP K P PP G P P G Sbjct: 309 ASPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP- 367 Query: 715 FFFXXPXXXKNXPPPPP 765 P K PPPPP Sbjct: 368 ---PPPGGKKGGPPPPP 381 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +1 Query: 730 PXXXKNXPPPPPX----XXPPPPPXKK 798 P K PPPPP PPPPP K Sbjct: 347 PPPAKGPPPPPPPKGPSPPPPPPPGGK 373 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 34.7 bits (76), Expect = 0.10 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 1/98 (1%) Frame = +1 Query: 499 PXGGXXKXXXWGAPPXXXXXKXPPPXXGFGG-GXPPXKXXPXFXXXFXXPPXXXGGGXPX 675 P GG APP PP GG G PP P PP GG P Sbjct: 1126 PIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPP 1185 Query: 676 PXKXXGXKKXFXFFFFXXPXXXKNXPPPPPXXXPPPPP 789 P G P P PP PPPP Sbjct: 1186 PPPPRGHGGVGG---PPTPPGAPAPPMPPGVPGGPPPP 1220 Score = 32.7 bits (71), Expect = 0.40 Identities = 23/75 (30%), Positives = 23/75 (30%) Frame = +1 Query: 565 PPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFXFFFFXXPXXXK 744 PPP GF GG PP PP GG P G P Sbjct: 1163 PPPPAGFRGGTPPPNAHGGVAPP--PPPPRGHGGVGGPPTPPGAPAP------PMPPGVP 1214 Query: 745 NXPPPPPXXXPPPPP 789 PPPPP P P Sbjct: 1215 GGPPPPPGGRGLPAP 1229 Score = 30.7 bits (66), Expect = 1.6 Identities = 28/92 (30%), Positives = 29/92 (31%), Gaps = 8/92 (8%) Frame = +1 Query: 538 PPXXXXXKXPPPXXGFGGG--XPPXKXXPXFXXXFXXPPXXXG-GGXPXPXKXXGXKKXF 708 PP PPP G GG PP P PP G GG P P G + Sbjct: 1114 PPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGT 1173 Query: 709 XFFFFXXPXXXKNXPPPPP-----XXXPPPPP 789 PPPPP PP PP Sbjct: 1174 P---PPNAHGGVAPPPPPPRGHGGVGGPPTPP 1202 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 34.7 bits (76), Expect = 0.10 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P N PPPPP PPPPP Sbjct: 342 PVQPSNAPPPPPPPPPPPPP 361 Score = 32.7 bits (71), Expect = 0.40 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP PPPPP K Sbjct: 352 PPPPPPPPPPPPPPK 366 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PPPPP K Sbjct: 351 PPPPPPPPPPPPPPPK 366 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 350 PPPPPPPPPPPPP 362 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 34.7 bits (76), Expect = 0.10 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PPPPP KK Sbjct: 367 PPPPPRPPPPPPPIKK 382 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 742 KNXPPPPPXXXPPPPP 789 K PPPPP PPPPP Sbjct: 350 KLMPPPPPPPPPPPPP 365 Score = 31.5 bits (68), Expect = 0.94 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP PPPPP + Sbjct: 358 PPPPPPPPPPPPPPR 372 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PPPPP K Sbjct: 366 PPPPPPRPPPPPPPIK 381 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 354 PPPPPPPPPPPPP 366 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 355 PPPPPPPPPPPPP 367 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 356 PPPPPPPPPPPPP 368 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 357 PPPPPPPPPPPPP 369 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 365 PPPPPPPRPPPPP 377 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 33.5 bits (73), Expect = 0.23 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 721 FXXPXXXKNXPPPPPXXXPPPPP 789 F P PPPPP PPPPP Sbjct: 45 FAPPPPQPTLPPPPPRTLPPPPP 67 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 719 FFXPPXXKKIXPPPPXGXXPPPP 787 F PP + PPPP PPPP Sbjct: 45 FAPPPPQPTLPPPPPRTLPPPPP 67 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 33.1 bits (72), Expect = 0.31 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 4/88 (4%) Frame = +1 Query: 538 PPXXXXXKXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFXFF 717 PP PP F PP P F P P P F Sbjct: 245 PPIPFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQL 304 Query: 718 ----FFXXPXXXKNXPPPPPXXXPPPPP 789 F PPPPP PPPPP Sbjct: 305 PPLPHFPPLPSFYPSPPPPPPPPPPPPP 332 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 745 NXPPPPPXXXPPPPP 789 N PPPPP PPPPP Sbjct: 26 NPPPPPPPPPPPPPP 40 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 29 PPPPPPPPPPPPP 41 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 33.1 bits (72), Expect = 0.31 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 742 KNXPPPPPXXXPPPPP 789 K+ PPPPP PPPPP Sbjct: 589 KSMPPPPPKSMPPPPP 604 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P +N PPPP PPPPP Sbjct: 545 PPPPRNMLPPPPKSMPPPPP 564 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPP 787 PP + + PPPP PPPP Sbjct: 545 PPPPRNMLPPPPKSMPPPPP 564 >01_06_1377 + 36764461-36765339 Length = 292 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 752 PPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 PPPP PPPP ++ GG PPPP Sbjct: 175 PPPPAYSAPPPPQYGSEQYYRSGGYY--SAPPPPP 207 >07_01_0080 + 587674-588510 Length = 278 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXKKXXFF 810 P PPPPP PPPPP F Sbjct: 97 PPPSSGSPPPPPPPPPPPPPPPPPPLF 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPPP PPPPP Sbjct: 96 PPPPSSGSPPPPPPPPPPPP 115 >12_02_1174 - 26696869-26698191 Length = 440 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPPPP PPPPP Sbjct: 146 PQPPPSLPPPPPPPPPPPPP 165 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 754 PPPPXXXPPPPPXK 795 PPPP PPPPP + Sbjct: 153 PPPPPPPPPPPPPR 166 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +1 Query: 730 PXXXKNXPPP--PPXXXPPPPP 789 P K PPP PP PPPPP Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPP 162 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PP PP K Sbjct: 156 PPPPPPPPPPRPPSVK 171 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPPPP PPPPP Sbjct: 76 PQTPPSPPPPPPPPPPPPPP 95 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + P PPP PPPPP Sbjct: 73 PPPPQTPPSPPPPPPPPPPP 92 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 32.3 bits (70), Expect = 0.54 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PPPPP ++ Sbjct: 15 PPPPPPPPPPPPPLRR 30 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 14 PPPPPPPPPPPPP 26 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 32.3 bits (70), Expect = 0.54 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKKXXFF 810 PPPPP PPPPP + ++ Sbjct: 54 PPPPPPPPPPPPPPRGRRYY 73 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 53 PPPPPPPPPPPPP 65 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 32.3 bits (70), Expect = 0.54 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXKKXXF 807 P + P PPP PPPPP K F Sbjct: 1937 PPPVEGKPKPPPHAPPPPPPEAKKSF 1962 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPPXXKK 799 PP + PPP PPPP KK Sbjct: 1937 PPPVEGKPKPPPHAPPPPPPEAKK 1960 >03_01_0515 - 3864796-3865425 Length = 209 Score = 32.3 bits (70), Expect = 0.54 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPPPP PPPPP Sbjct: 76 PPSVTSSPPPPPLPPPPPPP 95 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 91 PPPPPAASPPPPP 103 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP PPP P K Sbjct: 99 PPPPPPSPPPPSPVK 113 Score = 28.3 bits (60), Expect = 8.7 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 PP PPPP PPPP K PPP Sbjct: 76 PPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPP 118 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.9 bits (69), Expect = 0.71 Identities = 22/79 (27%), Positives = 24/79 (30%), Gaps = 3/79 (3%) Frame = +1 Query: 559 KXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFX---FFFFXX 729 K PPP PP K P PP P P + Sbjct: 1198 KSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAPVILS 1257 Query: 730 PXXXKNXPPPPPXXXPPPP 786 P K+ PPP P PPPP Sbjct: 1258 PPAVKSLPPPAPVSLPPPP 1276 Score = 31.1 bits (67), Expect = 1.2 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 2/81 (2%) Frame = +1 Query: 559 KXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPX--KXXGXKKXFXFFFFXXP 732 K PPP PP K P PP P P K P Sbjct: 1166 KSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILP 1225 Query: 733 XXXKNXPPPPPXXXPPPPPXK 795 PPPP PPPP K Sbjct: 1226 PPPVKSPPPPAPVISPPPPEK 1246 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 PP +K PPP PPPP K PPPP Sbjct: 1145 PPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPP 1187 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/88 (25%), Positives = 26/88 (29%) Frame = +1 Query: 535 APPXXXXXKXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFXF 714 +PP PPP P + P PP G P P K Sbjct: 789 SPPSEAHPTSPPPSEK-SPPTPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHV 847 Query: 715 FFFXXPXXXKNXPPPPPXXXPPPPPXKK 798 P K+ PPP PPP +K Sbjct: 848 ---SSPPPEKSSSPPPEAHVSSPPPPEK 872 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/81 (27%), Positives = 22/81 (27%), Gaps = 2/81 (2%) Frame = +1 Query: 559 KXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPX--KXXGXKKXFXFFFFXXP 732 K PP PP K P PP P P K P Sbjct: 1134 KPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILP 1193 Query: 733 XXXKNXPPPPPXXXPPPPPXK 795 PPPP PPPP K Sbjct: 1194 PPPVKSPPPPAPVISPPPPVK 1214 >03_02_0719 + 10654842-10654977,10655039-10655124,10655226-10657001, 10657782-10657926,10658017-10658735 Length = 953 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -2 Query: 786 GGGGXXPXGGGGXIFXXXGGXKKKKXKXFFXPPXF 682 GGGG GGGG +F +K + K F P F Sbjct: 13 GGGGGGGGGGGGGLFNLFDWKRKSRKKLFSNSPAF 47 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 31.9 bits (69), Expect = 0.71 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPPPP PPPPP Sbjct: 27 PPRTRVRPPPPPAPPPPPPP 46 Score = 31.5 bits (68), Expect = 0.94 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPP 787 PP ++ PPPP PPPP Sbjct: 26 PPPRTRVRPPPPPAPPPPPP 45 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 754 PPPPXXXPPPPPXK 795 PPPP PPPPP + Sbjct: 34 PPPPPAPPPPPPPR 47 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 31.5 bits (68), Expect = 0.94 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 742 KNXPPPPPXXXPPPPP 789 ++ PPPPP PPPPP Sbjct: 125 ESPPPPPPHPLPPPPP 140 >05_01_0380 + 2978256-2979284 Length = 342 Score = 31.5 bits (68), Expect = 0.94 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKKXXF 807 PPPPP PPPPP F Sbjct: 26 PPPPPPPPPPPPPPPPRPF 44 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 715 FFFXXPXXXKNXPPPPPXXXPPPP 786 F F P PPPPP PPPP Sbjct: 33 FTFLCPPPPPPPPPPPPPPPPPPP 56 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 38 PPPPPPPPPPPPP 50 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 39 PPPPPPPPPPPPP 51 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 40 PPPPPPPPPPPPP 52 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 41 PPPPPPPPPPPPP 53 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 42 PPPPPPPPPPPPP 54 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 43 PPPPPPPPPPPPP 55 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 44 PPPPPPPPPPPPP 56 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 31.5 bits (68), Expect = 0.94 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP PPPPP + Sbjct: 104 PPPPPPLRPPPPPAR 118 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 754 PPPPXXXPPPPPXKKXXF 807 PPPP PPPP K F Sbjct: 544 PPPPPPPPPPPSGNKPAF 561 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 563 PPPPPPPPPPPP 574 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 563 PPPPPPPPPPPP 574 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 P K PPP PPPP G K PPPP Sbjct: 656 PGIGNKFPAPPP----PPPPPRSSSRTPTGAATSSKGPPPPPP 694 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 22/83 (26%), Positives = 23/83 (27%), Gaps = 2/83 (2%) Frame = +1 Query: 538 PPXXXXXKXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGX--PXPXKXXGXKKXFX 711 PP PPP PP P PP G G P P + Sbjct: 625 PPLPNHSVLPPP--------PPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSS 676 Query: 712 FFFFXXPXXXKNXPPPPPXXXPP 780 K PPPPP PP Sbjct: 677 RTPTGAATSSKGPPPPPPPPLPP 699 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 754 PPPPXXXPPPPPXKK 798 PPPP PPPPP + Sbjct: 712 PPPP---PPPPPANR 723 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 26 PPPPPPHPPPPPP 38 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPP 786 P + PPPPP PPPP Sbjct: 20 PPELRLPPPPPPHPPPPPP 38 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 338 PPPPPPPPPPPPP 350 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 745 NXPPPPPXXXPPPP 786 N PPPPP PPPP Sbjct: 337 NPPPPPPPPPPPPP 350 >09_06_0148 - 21214460-21214561,21214993-21215339,21215428-21215538, 21215673-21215835,21215921-21215999,21216110-21216228 Length = 306 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 196 PPPPPPAAPPPPP 208 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 197 PPPPPAAPPPPPP 209 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPP PPPPP + Sbjct: 198 PPPPAAPPPPPPPAR 212 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 264 PPPPPPPPPPPPP 276 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXK 795 P + PPPPP PPP P + Sbjct: 259 PQSVRPPPPPPPPPPPPPMPPR 280 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPP 786 P PPPPP PPPP Sbjct: 258 PPQSVRPPPPPPPPPPPPP 276 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = +2 Query: 731 PXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 P + + PPPP PPPP + PPPP Sbjct: 257 PPPQSVRPPPPPPPPPPPPPMPPR---TDNASTQAAPAPPPP 295 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 635 FXXPPKXGXGXXPXXXXXGGXKKXXXFFFFXPPXXKKIXPPPPXGXXPPPP 787 F PP G P G FF PP ++ PPPP PP P Sbjct: 43 FPPPPPPGSTFVPLPQS-GVPPPPPLGSFFVPPPQSRVPPPPPQLGVPPLP 92 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/90 (24%), Positives = 23/90 (25%), Gaps = 7/90 (7%) Frame = +1 Query: 541 PXXXXXKXPPPXXGFGGGXPPXKXXPXFXXX-------FXXPPXXXGGGXPXPXKXXGXK 699 P + PP PP P F PP G P G Sbjct: 3 PHSDSSRPRPPSARLSAARPPASRPPRLEKGNFALPPPFGFPPPPPPGSTFVPLPQSGVP 62 Query: 700 KXFXFFFFXXPXXXKNXPPPPPXXXPPPPP 789 F P PPPPP PP P Sbjct: 63 PPPPLGSFFVPPPQSRVPPPPPQLGVPPLP 92 >08_02_1256 + 25645085-25645396 Length = 103 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 65 PPPPPLPSPPPPP 77 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 103 PPPPPPPPPPPPP 115 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 104 PPPPPPPPPPPPP 116 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 425 PPPPPLPPPPPPP 437 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 431 PPPPPPPPPPPPP 443 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 1157 PPPPPPPLPPPPP 1169 >07_03_0154 + 14509979-14512033 Length = 684 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 53 PPPPPPPPPPPPP 65 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 54 PPPPPPPPPPPPP 66 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 97 PPPPPELPPPPPP 109 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 10 PPPPPPPPPPPPP 22 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 11 PPPPPPPPPPPPP 23 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 27 PPPPPPSDPPPPP 39 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 28 PPPPPSDPPPPPP 40 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 718 FFXXPXXXKNXPPPPPXXXPPPPP 789 F P PPPP PPPPP Sbjct: 18 FSSRPRVVGPPPPPPSDPPPPPPP 41 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 365 PPPPPPPPPPPPP 377 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 366 PPPPPPPPPPPPP 378 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 395 PPPPPPTPPPPPP 407 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 746 IXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPP 853 + PPPP PPPP GG PPP Sbjct: 394 VPPPPPPTPPPPPPLLAPKQQSSGGPILPPAPAPPP 429 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 745 NXPPPPPXXXPPPPP 789 N PPPP PPPPP Sbjct: 362 NMRPPPPPPPPPPPP 376 >04_01_0354 - 4646826-4647314 Length = 162 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXKK 798 P N PPPP PPPPP ++ Sbjct: 85 PLPNLNLSPPPPPPPPPPPPQQQ 107 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKKXXF 807 PPPPP PPPP ++ + Sbjct: 93 PPPPPPPPPPPPQQQQQCY 111 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 398 PPPPPQPPPPPPP 410 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPP P PPPPP ++ Sbjct: 400 PPPQPPPPPPPPPHQR 415 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 742 KNXPPPPPXXXPPPPP 789 ++ P PPP PPPPP Sbjct: 393 QSGPAPPPPPQPPPPP 408 >03_03_0278 - 16126803-16129049 Length = 748 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKKXXFF 810 PPPPP P PPP K F+ Sbjct: 189 PPPPPRQAPAPPPAKPPTFW 208 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 273 PPPPPQAPPPPPP 285 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 731 PXXKKIXPPPPXGXXPPPP 787 P ++ PPPP PPPP Sbjct: 267 PPPPQVPPPPPQAPPPPPP 285 >02_03_0279 + 17250347-17252098 Length = 583 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 124 PPPPPPPPPPPPP 136 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 751 PPPPPXXXPPPPP 789 PPPPP PPPPP Sbjct: 76 PPPPPPPPPPPPP 88 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +1 Query: 535 APPXXXXXKXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXPXKXXGXKKXFXF 714 APP PPP G PP + P PP G P Sbjct: 16 APPPPQVSGAPPPPHGHYQQQPPPQ--PYCQQQQPLPPHYYQAGPPHAPPPQ-------- 65 Query: 715 FFFXXPXXXKNXPPPPPXXXPPPP 786 P PPPPP PPPP Sbjct: 66 ---QPPAMWGQPPPPPPQYAPPPP 86 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P PPPPP P PPP Sbjct: 82 PRRHHRIPPPPPPLLPTPPP 101 Score = 26.2 bits (55), Expect(2) = 2.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 754 PPPPXXXPPPPPXKK 798 PPPP PPP P K Sbjct: 115 PPPPAPAPPPTPTPK 129 Score = 22.6 bits (46), Expect(2) = 2.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 751 PPPPPXXXPP 780 PPPPP PP Sbjct: 73 PPPPPAPRPP 82 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = -1 Query: 541 GGPPKXXFXXXPRXGFXPPPPGXFXXKNSPPXFWKKEXFFWGGXPPXXXGG 389 GGPP G PPPP + N P + + GG PP GG Sbjct: 307 GGPPGYQGSNQGYQGPPPPPPSAYQGNN--PGYQGGGPGYQGGNPPPYQGG 355 >02_01_0091 + 646299-649082 Length = 927 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 722 FXPPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGG---XXKKKKXPPPP 856 F P K P PP P P +K + GGG KK P PP Sbjct: 75 FIPVNAKSAPPHPPSSSAPNPWRKRKFSWHDGGGEDIYAKKPTNPAPP 122 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 721 FXXPXXXKNXPPPPPXXXPPPPP 789 F P PPPP PPPPP Sbjct: 427 FEQPPPPPEHPPPPESTSPPPPP 449 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P PPPPP PPP P Sbjct: 438 PPPESTSPPPPPTSDPPPVP 457 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +2 Query: 719 FFXPPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 ++ PP + P P PPPP GGG PPPP Sbjct: 54 YYPPPPPPVVTPTPQC---PPPPSYPSGGGGGGGGGTVMYTSPPPP 96 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -2 Query: 855 GGGGXFFFFXXPPPXKKXXFFXXGGGGXXPXGGGGXIFXXXGG 727 GGGG + PPP GGGG GGGG + G Sbjct: 83 GGGGTVMYTSPPPPYS-------GGGGGSSTGGGGIYYPPPTG 118 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 25.0 bits (52), Expect(2) = 2.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPP P Sbjct: 46 PPPPQAAPPPAP 57 Score = 23.8 bits (49), Expect(2) = 2.2 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 538 PPXXXXXKXPPPXXGFGGGXPPXKXXPXFXXXFXXPPXXXGGGXPXP 678 PP PPP F G PP P PP G P P Sbjct: 6 PPPQWAMGPPPPPQYFQAGPPP---PPPQYFQGAHPPAAMWGQPPPP 49 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 746 IXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 + PPPP G PPPP + G PPPP Sbjct: 28 VAPPPPMGPPPPPPMPPVPVMYLRG-------VPPPP 57 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P ++ PPPP PPPPP Sbjct: 34 PASPRSPVPPPPGVPPPPPP 53 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXKK 798 P + PPPPP PPP P ++ Sbjct: 186 PIQGSSVPPPPPPPPPPPQPEQQ 208 >12_02_0848 + 23636478-23638058 Length = 526 Score = 29.5 bits (63), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 754 PPPPXXXPPPPPXKK 798 PPPP PPPPP ++ Sbjct: 74 PPPPSTSPPPPPPRR 88 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPP PPPPP + Sbjct: 74 PPPPSTSPPPPPPRR 88 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 787 GGGGXXPXGGGGXYFFXXGGXKKKKXXXFFXP 692 GGGG GGGG Y + GG + ++ P Sbjct: 112 GGGGGAGGGGGGGYGYGAGGGYGQAGGPYYGP 143 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P ++ PPPPP PPPP Sbjct: 28 PAIPESGPPPPPAPDMPPPP 47 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPP P PPPPP K Sbjct: 591 PPPAPKAAPPPPPPK 605 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 742 KNXPPPPPXXXPPPPP 789 K PPPPP PPP P Sbjct: 74 KQTPPPPPPPPPPPSP 89 >05_06_0063 + 25289117-25290643 Length = 508 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPP 786 P + PPPPP PPPP Sbjct: 318 PELEPSEPPPPPPFPPPPP 336 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 325 PPPPPPFPPPPP 336 >03_06_0301 - 32974276-32974638,32974842-32974967,32975056-32975131, 32975935-32976130,32976666-32976759,32977773-32978195 Length = 425 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 834 FFXXPPPXKKXXFFXXGGGGXXPXGGGGXIFXXXGG 727 F+ PPP + GGG GGGG + GG Sbjct: 14 FWVPPPPPQSAAAAQQQGGGGVASGGGGGVAGGGGG 49 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -2 Query: 837 FFFXXPPPXKKXXFFXXGGGGXXPXGGGGXIFXXXGG 727 F+ PPP GGGG GGGG GG Sbjct: 14 FWVPPPPPQSAAAAQQQGGGGVASGGGGGVAGGGGGG 50 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPPXK 795 P + PPPPP P PPP K Sbjct: 224 PPKKEPPPPPPPKQEPCPPPPK 245 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP P P P KK Sbjct: 173 PPPPPAPEPEPEPPKK 188 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 P PPP PPPPP K Sbjct: 14 PTPPPPPPPPPPPAK 28 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +2 Query: 719 FFXPPXXKKIXPPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 ++ PP PPP PP + GGG K PPPP Sbjct: 62 YYDPPHSPDYYDPPPSPDYYDPPPSP----YYGGGGGYGKPPPPPP 103 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPP 786 P + PPPPP PPPP Sbjct: 136 PHPPDHPPPPPPCRVPPPP 154 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPPPP PPPP Sbjct: 135 PPHPPDHPPPPPPCRVPPPP 154 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPP 786 P + PPPPP PPPP Sbjct: 415 PPTHTHGPPPPPPPPPPPP 433 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/48 (35%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +2 Query: 728 PPXXKKIXPPPPXGXXPPPP--XXKKXXFFXGGGXXKKKKXP---PPP 856 PP PPPP PPPP + G G K+ + P PPP Sbjct: 414 PPPTHTHGPPPPPPPPPPPPVGYWESRVRKPGTGTSKETRSPALSPPP 461 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/18 (61%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = +1 Query: 751 PPPP--PXXXPPPPPXKK 798 PPPP P PPPPP +K Sbjct: 359 PPPPFAPTLPPPPPPRRK 376 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 422 PPPPPPPPPPPP 433 >12_02_0326 + 17555731-17556387 Length = 218 Score = 29.1 bits (62), Expect = 5.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPP PPPPP ++ Sbjct: 203 PPPPALPPPPPPPPRR 218 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPP 786 P + PPPPP PPPP Sbjct: 397 PTFTYSSPPPPPLYYPPPP 415 >09_04_0365 - 16962608-16963174,16963301-16963486,16963824-16963896, 16964307-16964497,16964982-16965198,16965394-16965797, 16966593-16966658,16966668-16966721,16966945-16967079, 16967194-16967391,16967734-16967918,16968990-16969527 Length = 937 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP PP PP K Sbjct: 27 PPPPPPPTPPRPPQK 41 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP P PPP K Sbjct: 154 PPPPPHAPPGPPPTK 168 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PP PP K Sbjct: 153 PPPPPPHAPPGPPPTK 168 >08_01_0059 - 394001-394708 Length = 235 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPP P PPPPP Sbjct: 19 PPPRRAPPPPSPPIRPPPPP 38 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 3 PPPPPRRAPPPP 14 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 17 PPPPPRRAPPPP 28 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P K P PPP PPPPP Sbjct: 299 PELSKLPPIPPPPPPPPPPP 318 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P + PPPPP P PPP Sbjct: 47 PSPPRPPPPPPPPTQPAPPP 66 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +2 Query: 752 PPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPPP 856 PPPP PPPP K + G ++ PPPP Sbjct: 126 PPPP----PPPPPPFKGDHYGGVYQNWQQNGPPPP 156 >10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 Length = 190 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 742 KNXPPPPPXXXPPPPP 789 ++ P PPP PPPPP Sbjct: 10 RSAPAPPPPPTPPPPP 25 >09_03_0145 - 12749288-12751510 Length = 740 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 718 FFXXPXXXKNXPPPPPXXXPPPPP 789 F P PPPPP PPPP Sbjct: 21 FKPKPTNPSPPPPPPPPGIQPPPP 44 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P PPPPP PPPP Sbjct: 30 PIRNPTPPPPPPRRRTPPPP 49 >07_01_0479 + 3606663-3607448 Length = 261 Score = 28.7 bits (61), Expect = 6.6 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = -1 Query: 607 FXGGXPPQNPXXXXXXFXXXXXGGPPKXXFXXXP----RXGFXPPPPGXFXXKNSPP 449 F G PP P GGPP P R G PPPPG +PP Sbjct: 208 FMRGPPPMGPPQVRPGMP----GGPPPGMRPGMPPPPFRPGMPPPPPGPQQPGQNPP 260 >04_04_1351 - 32827136-32827984 Length = 282 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 786 GGGGXXPXGGGGXIFXXXGG 727 GGGG P GGGG I GG Sbjct: 32 GGGGSAPSGGGGGIGGVVGG 51 >03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 Length = 138 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 730 PXXXKNXPPPPPXXXPPPPP 789 P P PPP PPPPP Sbjct: 82 PDDPPKKPDPPPPCPPPPPP 101 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 752 PPPPXGXXPPPPXXKKXXFFXGGGXXKKKKXPPP 853 PPPP PPPP GGG + + PPP Sbjct: 10 PPPPPPQHPPPPQA------GGGGGGEFYRGPPP 37 >01_05_0490 + 22672241-22674679 Length = 812 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 697 KKXFXFFFFXXPXXXKNXPPPPPXXXPPPPP 789 ++ ++ + P PPPPP PPPPP Sbjct: 679 RRAVVYYTYPLPPPSPPLPPPPP---PPPPP 706 >12_02_1070 - 25814741-25815850 Length = 369 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 237 PPPPPPPPPPPP 248 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 237 PPPPPPPPPPPP 248 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 39 PPPPPPPPPPPP 50 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 39 PPPPPPPPPPPP 50 >12_01_0495 - 3935395-3937110 Length = 571 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 5 PPPPLPPPPPPP 16 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PP PP PPPPP K Sbjct: 617 PPRPPGAPPPPPPPGK 632 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PP PP PPPPP + Sbjct: 84 PPSPPPPPPPPPPPR 98 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PP PP PPPPP K Sbjct: 922 PPRPPGAPPPPPPPGK 937 >08_01_0060 - 413088-413999 Length = 303 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 29 PPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 29 PPPPPPPPPPPP 40 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 28.3 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 751 PPPPPXXXPPPPPXKK 798 PPPPP PP PP K Sbjct: 16 PPPPPPPPPPLPPAHK 31 >07_03_1636 + 28290642-28291574 Length = 310 Score = 28.3 bits (60), Expect = 8.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -1 Query: 535 PPKXXFXXXPRXGFXPPPPGXFXXKNSPP 449 PP+ P + PPPP + K SPP Sbjct: 155 PPQLFETAPPSPPYVPPPPDAYLRKPSPP 183 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 43 PPPPPPPPPPPP 54 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 43 PPPPPPPPPPPP 54 >07_01_0516 - 3850252-3852870 Length = 872 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP P PPP + Sbjct: 31 PPPPPAHGPSPPPPR 45 >07_01_0052 - 411927-412589 Length = 220 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 204 PPPPPHHRPPPP 215 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 28.3 bits (60), Expect = 8.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 712 FFFFXXPXXXKNXPPPPPXXXPPPPP 789 F P + PPPPP PPPPP Sbjct: 18 FLLQSSPTSSSSSPPPPP---PPPPP 40 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 117 PPPPPPPPPPPP 128 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 117 PPPPPPPPPPPP 128 >05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605, 5184024-5184143,5184247-5184375,5184466-5184591, 5185550-5185667,5186471-5186680,5186788-5187100, 5187467-5187560,5187760-5187868,5188322-5188593, 5188684-5188811,5188977-5189211,5189794-5189982, 5190069-5190349,5190431-5190698,5190719-5190961, 5191598-5191680,5192484-5192493 Length = 1366 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 56 PPPPPSLPPPPP 67 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 56 PPPPPSLPPPPP 67 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 579 PPPPPPPPPPPP 590 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 579 PPPPPPPPPPPP 590 >05_01_0141 - 937428-937717,938483-938705 Length = 170 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 40 PPPPTAYPPPPP 51 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 26 PPPPPPPPPPPP 37 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 26 PPPPPPPPPPPP 37 >04_04_0746 + 27726736-27727118,27727518-27727544,27728042-27728126, 27729252-27729809 Length = 350 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 33 PPPPALPPPPPP 44 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 549 PPPPPPPPPPPP 560 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 549 PPPPPPPPPPPP 560 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 355 PPPPPPPPPPPP 366 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 355 PPPPPPPPPPPP 366 >03_05_0843 + 28126480-28127007,28127092-28127457,28129388-28129487, 28130266-28130546,28130643-28130705,28131276-28131431, 28131913-28132080,28132158-28132298,28132714-28132840, 28132888-28132994,28134142-28134372,28134446-28134559, 28135091-28135261 Length = 850 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 38 PPPPPPLPPPPP 49 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 38 PPPPPPLPPPPP 49 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 428 PPPPPPPPPPPP 439 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 428 PPPPPPPPPPPP 439 >03_02_0738 - 10824121-10825572 Length = 483 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 95 PPPPPPSSPPPP 106 >03_01_0593 + 4379263-4379377,4380359-4380491,4380585-4380656, 4380739-4380813,4380896-4380967,4381055-4381126, 4381251-4381322,4381403-4381468,4381547-4381612, 4381689-4381978,4382072-4382355,4382690-4382961, 4383411-4383546,4383840-4383970,4384078-4384234, 4384334-4384477 Length = 718 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 260 PPPPPYSAPPPP 271 >02_01_0148 - 1051121-1051192,1051378-1051512,1052343-1052396, 1052501-1052581,1052667-1052826,1053346-1053453, 1053543-1053718,1053952-1054002,1054154-1054264, 1054493-1054547,1055667-1055789,1055922-1056007, 1056235-1056349,1056429-1056667 Length = 521 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 7 PPPPPSSPPPPP 18 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 7 PPPPPSSPPPPP 18 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 2 PPPPPPPPPPPP 13 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 2 PPPPPPPPPPPP 13 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 751 PPPPPXXXPPPPPXK 795 PPPPP PPP P + Sbjct: 3 PPPPPPPPPPPSPPR 17 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 742 KNXPPPPPXXXPPPPP 789 + PP PP PPPPP Sbjct: 73 RTPPPTPPSPPPPPPP 88 >01_01_0046 - 331758-332627 Length = 289 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 751 PPPPPXXXPPPP 786 PPPPP PPPP Sbjct: 21 PPPPPPPPPPPP 32 Score = 28.3 bits (60), Expect = 8.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 754 PPPPXXXPPPPP 789 PPPP PPPPP Sbjct: 21 PPPPPPPPPPPP 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,218,935 Number of Sequences: 37544 Number of extensions: 556493 Number of successful extensions: 9136 Number of sequences better than 10.0: 113 Number of HSP's better than 10.0 without gapping: 1906 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5236 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2518669100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -