BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B15 (926 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 2.6 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 23 4.5 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 22 5.9 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 23.4 bits (48), Expect = 2.6 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 534 FKNFVSQNLRKLHEKHDFGDKRSQAFS 454 F NFVSQ+L K + F +RS S Sbjct: 309 FSNFVSQHLPKFSAANFFDIERSTILS 335 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 355 SWSQTYIATFSVVLAIVLKYGTSLSKFLWS 266 +W TY +L V+KYG +L +L S Sbjct: 99 AWDITYRFYGGFLLCKVVKYGQTLGPYLSS 128 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 22.2 bits (45), Expect = 5.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 60 FSSAHRLHSPFLSDEENKK 116 FSS R HS L +E+N+K Sbjct: 230 FSSPRRRHSINLLEEDNQK 248 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,102 Number of Sequences: 336 Number of extensions: 4379 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25961683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -