BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B15 (926 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 3.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 5.2 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.0 bits (47), Expect = 3.9 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -2 Query: 352 WSQTYIATFSVVLAIVLKYGTSLSKFLWSS 263 W Q + + +I+L GT+L + +W + Sbjct: 267 WGQGHAILKGLKTSIILMNGTTLPQIMWGT 296 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.6 bits (46), Expect = 5.2 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 704 IGYAPYVMT**LQIXFLFMIGYLIKYLF 787 IGYA VM+ + + ++ ++ + I Y F Sbjct: 62 IGYAAAVMSCWMNVYYIVILAWAIFYFF 89 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,842 Number of Sequences: 438 Number of extensions: 4902 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30234750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -