BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B13 (886 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 1.6 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 2.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 6.5 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 8.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 8.6 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/43 (23%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 103 GIDQLRDDCMETYWQS-DGQLPHLVNIQFQKKTMVSHIYIYTD 228 G ++ ++ +E W +N++ +KK +SH ++YT+ Sbjct: 425 GFSKIAENLLEKNWLPVHTSYKSGLNLEQEKKDSISHYHLYTN 467 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.8 bits (49), Expect = 2.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 643 FVSIFVIYLFSYEQLLFRNNCYKENSN 723 F++I V Y F+Y R N Y NSN Sbjct: 435 FLAINVFYWFAYLSRSERINYYNVNSN 461 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 6.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 88 CKPGFGIDQLRDDCME 135 CKPG+ D + +C E Sbjct: 249 CKPGYQADVEKQECTE 264 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 8.6 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -1 Query: 268 LIFCLVYSFHLIYSQ 224 + FC V+ FHL++++ Sbjct: 209 MTFCRVFPFHLMFNR 223 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 8.6 Identities = 6/15 (40%), Positives = 12/15 (80%) Frame = -1 Query: 268 LIFCLVYSFHLIYSQ 224 + FC V+ FHL++++ Sbjct: 209 MTFCRVFPFHLMFNR 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,362 Number of Sequences: 438 Number of extensions: 4213 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28766349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -