BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B13 (886 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18290.1 68415.m02132 anaphase-promoting complex, subunit 10 ... 179 2e-45 At2g18350.1 68415.m02138 zinc finger homeobox family protein / Z... 28 7.2 At1g19260.1 68414.m02396 hAT dimerisation domain-containing prot... 28 9.5 >At2g18290.1 68415.m02132 anaphase-promoting complex, subunit 10 family / APC10 family contains Pfam PF03256: Anaphase-promoting complex, subunit 10 (APC10) domain; similar to anaphase promoting complex subunit APC10 (GI:6463666) [Homo sapiens] Length = 192 Score = 179 bits (436), Expect = 2e-45 Identities = 82/154 (53%), Positives = 114/154 (74%), Gaps = 2/154 (1%) Frame = +1 Query: 88 CKPGFGIDQLRDDCMETYWQSDGQLPHLVNIQFQKKTMVSHIYIYTDYKLDESYTPSRIS 267 CKPG G+ LRDD +ETYWQSDG PHL+NIQFQKK + + +Y D+KLDESYTPS+IS Sbjct: 41 CKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVLYVDFKLDESYTPSKIS 100 Query: 268 IRAGTHFNDLQEIEVIELIEPSGWEMIPIK--DIHDRPIRTYMIQIAVLSNHQNGRDTHM 441 IRAG F++L+EI+ +EL++P+GW + + D + + T+M+QIA+LSNH NGRDTH+ Sbjct: 101 IRAGDGFHNLKEIKSVELVKPTGWVCLSLSGTDPRETFVNTFMLQIAILSNHLNGRDTHI 160 Query: 442 RQIKVHSPCEPTSFDINKFRNFSTVQFQQYATIR 543 RQIKV+ P P F+ F++++F Y+T+R Sbjct: 161 RQIKVYGP-RPNPIPHQPFQ-FTSMEFLTYSTLR 192 >At2g18350.1 68415.m02138 zinc finger homeobox family protein / ZF-HD homeobox family protein Length = 262 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Frame = +1 Query: 220 YTDYKLDE--SYTPSRISIRAGTHFNDLQEIEVIELIEPSGWEMIPIKD 360 ++ Y +D+ Y P + R T FN+ Q+ +++E E GW M ++D Sbjct: 184 FSGYGVDQFHHYQPKK---RFRTKFNEEQKEKMMEFAEKIGWRMTKLED 229 >At1g19260.1 68414.m02396 hAT dimerisation domain-containing protein Length = 769 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 400 AVLSNHQNGRDTHMRQIKVHSPCEP 474 ++LS H N RD R+ + PC+P Sbjct: 29 SILSYHPNQRDEVRREYLIRGPCQP 53 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,880,664 Number of Sequences: 28952 Number of extensions: 307414 Number of successful extensions: 623 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2071520424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -