BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B10 (890 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 1.3 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 25 2.3 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 25 2.3 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 25 2.3 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 25 2.3 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 25 2.3 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 25 2.3 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 25 2.3 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 3.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 5.4 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 5.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 5.4 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 24 7.1 AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 24 7.1 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 9.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 9.4 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 26.2 bits (55), Expect = 1.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 635 HQTQCDNNGHPSISCYQI*KCGCSEN 558 H CD +G C Q +C C++N Sbjct: 985 HACDCDPSGSKGSQCNQYGQCPCNDN 1010 Score = 23.4 bits (48), Expect = 9.4 Identities = 14/59 (23%), Positives = 21/59 (35%) Frame = -1 Query: 785 PSCTHQIGPPKEANWSNDSSHNTSVRHPC*LFSPKSRCVLHSSYYHARTNHQTQCDNNG 609 P C + +A W +S N PC ++C Y+ T H C + G Sbjct: 314 PDCDRCLPFYNDAPWGRATSKNVHECKPCNCNGYSTKCFFDRHLYNL-TGHGGHCIDCG 371 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNL 748 ++ +GA W+Y +CH SNL Sbjct: 262 VTCEGA-WWYNNCHHSNL 278 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNL 748 ++ +GA W+Y +CH SNL Sbjct: 262 VTCEGA-WWYNNCHHSNL 278 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNL 748 ++ +GA W+Y +CH SNL Sbjct: 262 VTCEGA-WWYNNCHHSNL 278 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNL 748 ++ +GA W+Y +CH SNL Sbjct: 262 VTCEGA-WWYNNCHHSNL 278 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNL 748 ++ +GA W+Y +CH SNL Sbjct: 262 VTCEGA-WWYNNCHHSNL 278 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNL 748 ++ +GA W+Y +CH SNL Sbjct: 262 VTCEGA-WWYNNCHHSNL 278 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNL 748 ++ +GA W+Y +CH SNL Sbjct: 262 VTCEGA-WWYNNCHHSNL 278 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.0 bits (52), Expect = 3.1 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 352 SSRC-HESLPKCGL*ACSDPCSRFSCI 275 +SRC H PK + +C PC + +CI Sbjct: 18 ASRCVHRRCPKNEVYSCCAPCPQKACI 44 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.2 bits (50), Expect = 5.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 695 ISMDGAHWYYGSCHCSNLLPWVAQSDACSLVHCWCSWGSEYNCSVCTIW 841 I M AH + SC CS+++ VA D ++ C + Y + IW Sbjct: 1868 IHMHAAHSLFPSCLCSSVMQIVACLDDAAVNSDGC---AVYEVAYQVIW 1913 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 318 PHFGRDSWHLLDQMHSAWARVH 383 PH R H++ +MH A+++VH Sbjct: 38 PH-SRHHVHMMPEMHGAYSQVH 58 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 24.2 bits (50), Expect = 5.4 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 318 PHFGRDSWHLLDQMHSAWARVH 383 PH R H++ +MH A+++VH Sbjct: 38 PH-SRHHVHMMPEMHGAYSQVH 58 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.8 bits (49), Expect = 7.1 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = +2 Query: 245 FVPRNYVVRNYAREPRTR-VATRSQPTLRERLMAPAGPNA 361 FVP N++ RN A VA +SQ +RE ++AP +A Sbjct: 210 FVPVNFLNRNTAAATANDWVARKSQGLIRE-IVAPTALDA 248 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 23.8 bits (49), Expect = 7.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 760 HPRKQIGAMTAPIIPVCAIHANCLAPNPGV 671 H + G A ++ VCAI+A NP + Sbjct: 90 HSQAGPGTHAAHVVRVCAINAGLTGANPNL 119 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.4 bits (48), Expect = 9.4 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 334 THGTCWTKCIQLGQGCISWSLCSWTSC 414 TH + C ++G+ C++ S C SC Sbjct: 159 THTSVPKMCAKIGEYCLTSSECCSKSC 185 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 9.4 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 400 SWTSCSVLLWLWGKTRYSSXNLTF 471 SW + ++L+ + G+T + NLTF Sbjct: 912 SWPTLNLLISIMGRTMGALGNLTF 935 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,003,563 Number of Sequences: 2352 Number of extensions: 22521 Number of successful extensions: 67 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95920632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -