BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B09 (942 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. 146 3e-37 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 7.0 >X91509-1|CAA62809.1| 103|Apis mellifera histone H4 protein. Length = 103 Score = 146 bits (354), Expect = 3e-37 Identities = 73/77 (94%), Positives = 73/77 (94%) Frame = +3 Query: 150 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRSVLKVFLENVIRDAVTYTEHAKRKT 329 VL DNIQGITKPAIRRLARRGGVKRISGLIYEETR VLKVFLENVIRDAVTYTEH KRKT Sbjct: 22 VLGDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHTKRKT 81 Query: 330 VTAMDVVYALKRQGRTL 380 VTAMDVVYALK QGRTL Sbjct: 82 VTAMDVVYALKIQGRTL 98 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.2 bits (45), Expect = 7.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -2 Query: 248 FLVNQAGYTFDAAASRQSSNGRLRYSLNIISE 153 F+V G A R++S L SLN+I E Sbjct: 6 FMVACLGIACQGAIVRENSPRNLEKSLNVIHE 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,936 Number of Sequences: 438 Number of extensions: 2091 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30839445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -