BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_B05 (998 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 55 8e-08 01_03_0005 + 11568545-11569119,11569179-11569191 46 6e-05 07_03_1136 + 24218601-24218734,24218769-24219906 44 1e-04 02_05_0686 - 30900748-30902167,30903442-30904742 44 3e-04 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 43 3e-04 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 42 8e-04 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 40 0.002 01_05_0490 + 22672241-22674679 40 0.003 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 40 0.004 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 38 0.009 07_01_0080 + 587674-588510 38 0.017 12_02_1174 - 26696869-26698191 37 0.022 05_01_0141 - 937428-937717,938483-938705 37 0.022 09_02_0495 + 9880714-9881196 37 0.029 02_05_0149 + 26290236-26290880 36 0.038 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 36 0.051 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 36 0.067 09_02_0543 + 10427321-10428315,10428440-10429154 35 0.088 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 35 0.088 02_04_0400 - 22608519-22608844,22609044-22609122 35 0.088 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 35 0.12 07_03_0600 + 19866757-19867218,19867920-19868429 35 0.12 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 35 0.12 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 35 0.12 04_03_0803 - 19835284-19836050,19836337-19836418 34 0.15 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 34 0.20 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 34 0.20 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.27 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 33 0.27 12_01_0399 + 3152219-3152721,3152995-3153127,3155013-3155097,315... 33 0.36 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 33 0.36 04_03_1022 - 21778315-21779007 33 0.36 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 33 0.36 01_06_0146 + 26969011-26969995,26970878-26970930 33 0.36 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 33 0.47 08_01_0059 - 394001-394708 33 0.47 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 33 0.47 05_01_0131 + 888247-888771,889092-889154 33 0.47 03_01_0515 - 3864796-3865425 33 0.47 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 30 0.47 04_01_0197 + 2323790-2324098,2324145-2324774 30 0.51 11_01_0364 - 2790450-2790464,2790601-2791116 32 0.62 03_02_0436 + 8427018-8427707,8429005-8429544 32 0.62 01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 32 0.62 11_06_0016 - 19284810-19284926,19285527-19286879 32 0.82 08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287,164... 32 0.82 07_03_0559 + 19475893-19476783 32 0.82 06_02_0127 + 12140843-12140966,12141170-12141567 32 0.82 04_04_0057 + 22410167-22411330 32 0.82 03_02_0085 - 5539188-5539388,5539576-5539714,5540108-5540279,554... 32 0.82 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 32 0.82 10_08_0216 - 15942379-15942852,15942956-15943033 31 1.1 07_01_0753 - 5799733-5799741,5799938-5800642 31 1.1 01_07_0255 - 42322111-42322308,42322658-42322750,42323127-423233... 31 1.1 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 1.1 09_02_0327 - 7284829-7284889,7284946-7286126 29 1.1 05_01_0380 + 2978256-2979284 29 1.1 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 25 1.3 12_02_1070 - 25814741-25815850 28 1.4 08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879,372... 31 1.4 07_03_0890 - 22332768-22333382 31 1.4 07_01_0479 + 3606663-3607448 31 1.4 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 31 1.4 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 31 1.4 08_02_0796 - 21300251-21300373,21300846-21301721 29 1.4 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 30 1.8 01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567,925... 25 1.8 04_04_1687 - 35365766-35366356,35367137-35368135 28 1.8 09_04_0258 - 16175258-16176069,16176111-16176414 27 1.9 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 31 1.9 11_01_0385 + 2915532-2916482 31 1.9 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 31 1.9 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 31 1.9 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 31 1.9 06_01_1181 + 10148653-10149405 31 1.9 05_07_0031 - 27183252-27183317,27183542-27184282 31 1.9 02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113... 31 1.9 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 31 1.9 01_06_0565 + 30287253-30287502,30287522-30289010,30289133-302892... 31 1.9 05_03_0637 - 16465433-16466242 26 1.9 03_02_0865 - 11895257-11895340,11896004-11896069,11896297-118963... 25 2.4 12_01_0442 + 3495333-3496484 25 2.4 11_06_0610 - 25449085-25453284 30 2.5 11_01_0133 + 1121392-1122731,1123417-1123858 30 2.5 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 30 2.5 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 30 2.5 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 2.5 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 30 2.5 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 23 2.8 05_01_0267 + 2050854-2051682,2051864-2051921,2052518-2052608 25 3.2 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 30 3.3 09_03_0145 - 12749288-12751510 30 3.3 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 30 3.3 07_03_1713 + 28939446-28939574,28939674-28940231,28940338-289404... 30 3.3 07_01_0862 - 7172083-7172931 30 3.3 06_03_1414 + 30012195-30012360,30012448-30012830 30 3.3 05_04_0173 + 18724367-18724476,18724570-18724651,18724750-187248... 30 3.3 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 30 3.3 04_04_0201 - 23555336-23556008,23556097-23556258,23556353-235572... 30 3.3 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 30 3.3 01_03_0202 - 13762042-13762572 25 3.4 01_03_0076 - 12241408-12241545,12241719-12241790,12242173-122422... 24 3.8 12_02_0326 + 17555731-17556387 29 4.4 12_01_1043 + 10731454-10732131 29 4.4 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 4.4 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 29 4.4 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 4.4 07_03_0820 - 21749477-21749866,21751192-21751590 29 4.4 07_03_0558 + 19461369-19462448 29 4.4 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 29 4.4 06_01_0486 - 3455030-3455770 29 4.4 05_06_0282 + 26915249-26915881 29 4.4 05_05_0190 - 23110152-23112137 29 4.4 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 29 4.4 04_03_0801 - 19828175-19828770,19828913-19828994 29 4.4 02_04_0563 - 23895573-23895614,23896330-23896390,23896901-238970... 29 4.4 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 4.4 02_01_0158 - 1103461-1104186 29 4.4 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 24 5.0 01_01_0796 + 6190931-6192745 27 5.1 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 27 5.2 05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 27 5.3 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 27 5.4 12_01_0319 + 2440129-2440661,2440875-2440902 25 5.7 05_07_0284 - 28943527-28943625,28944417-28944785 25 5.8 12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203,219... 29 5.8 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 29 5.8 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 29 5.8 09_04_0112 - 14757947-14758972 29 5.8 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 29 5.8 06_03_0790 - 24636805-24637770 29 5.8 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 29 5.8 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 5.8 05_04_0011 + 17139322-17139451,17139552-17140174 29 5.8 03_05_0688 + 26762668-26762893,26763027-26763101,26763865-267640... 29 5.8 03_05_0234 - 22200754-22201476 29 5.8 03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828,997... 29 5.8 01_05_0552 - 23173106-23173184,23173266-23173411,23173543-231740... 29 5.8 01_01_0715 - 5542648-5543219,5543352-5543544 29 5.8 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 24 5.9 03_02_0178 + 6195402-6199158,6199438-6200003 24 6.1 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 23 6.2 10_01_0086 - 1064650-1065379,1065796-1065950,1066029-1066141,106... 24 6.6 03_05_1016 + 29726949-29727503,29728863-29729504 24 6.8 02_05_0714 - 31164078-31164554 25 7.5 12_02_0640 - 21447470-21448309 29 7.7 12_02_0635 - 21430245-21431156 29 7.7 11_06_0561 - 24984960-24985205,24985283-24985354,24985906-249859... 29 7.7 11_06_0046 - 19585032-19585109,19585198-19585278,19585460-195855... 29 7.7 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 7.7 10_04_0005 + 7390697-7390705,7390943-7391096,7391225-7391424,739... 29 7.7 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 29 7.7 09_02_0603 - 11150739-11150746,11150791-11151340 29 7.7 07_03_1751 - 29215074-29216270 29 7.7 07_03_0154 + 14509979-14512033 29 7.7 06_03_1310 + 29238644-29240260 29 7.7 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 29 7.7 05_07_0294 - 29038259-29038420,29038526-29038632,29038889-290390... 29 7.7 04_01_0354 - 4646826-4647314 29 7.7 04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626,184... 29 7.7 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 7.7 02_03_0279 + 17250347-17252098 29 7.7 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 7.7 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 7.7 01_05_0433 - 22094784-22095659 29 7.7 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 7.7 01_01_0762 + 5889925-5890136,5891110-5891273,5891755-5891878,589... 29 7.7 01_01_0553 - 4067921-4068180,4068437-4068455,4069101-4070225 29 7.7 05_03_0001 - 7269231-7269436,7269536-7270100,7270600-7270821,727... 24 8.3 05_04_0347 + 20479682-20479753,20480136-20480813,20481143-204821... 24 8.3 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 26 8.5 12_01_0841 - 7873458-7874225 25 9.2 10_08_0213 - 15912048-15912716 25 9.3 02_01_0143 + 1030081-1030587,1032106-1032114 24 9.6 12_01_0838 - 7830944-7831444 25 9.6 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 55.2 bits (127), Expect = 8e-08 Identities = 33/95 (34%), Positives = 36/95 (37%), Gaps = 6/95 (6%) Frame = -1 Query: 752 GGXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXX-APXXXXXXXXXGXPPPPPPXX 576 G PP +G G PPP G PPPP AP G PPPPP Sbjct: 1096 GVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVG 1155 Query: 575 GXG--XXFPXGGGXKXXYXPP---XXPXPPPPPPK 486 G G P G + PP PPPPPP+ Sbjct: 1156 GLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPR 1190 Score = 52.8 bits (121), Expect = 4e-07 Identities = 31/86 (36%), Positives = 31/86 (36%), Gaps = 2/86 (2%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 PP G G PPP G G PPP P G PPPPP G G Sbjct: 1139 PPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHG---GVAPPPPPPRGHGGV 1195 Query: 560 F--PXGGGXKXXYXPPXXPXPPPPPP 489 P G PP P PPPPP Sbjct: 1196 GGPPTPPGAPAPPMPPGVPGGPPPPP 1221 Score = 48.0 bits (109), Expect = 1e-05 Identities = 32/103 (31%), Positives = 34/103 (33%), Gaps = 4/103 (3%) Frame = -1 Query: 788 GXPXXXXRPXXVGGXXPPXXVGG--GXXXPP--PXXXGXGXXXPPPPXXXXXXXAPXXXX 621 G P P + G PP +GG G PP P G G PPPP P Sbjct: 1107 GAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGP-PAPPP 1165 Query: 620 XXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 G PPP G P G PP P P PP Sbjct: 1166 PAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPP 1208 Score = 44.8 bits (101), Expect = 1e-04 Identities = 28/81 (34%), Positives = 28/81 (34%) Frame = -1 Query: 788 GXPXXXXRPXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXX 609 G P P G PP GG PPP G G PP AP Sbjct: 1158 GGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPG----APAPPMPPGV 1213 Query: 608 XGXPPPPPPXXGXGXXFPXGG 546 G PPPPP G G P GG Sbjct: 1214 PGGPPPPP--GGRGLPAPPGG 1232 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/87 (33%), Positives = 30/87 (34%), Gaps = 2/87 (2%) Frame = +3 Query: 507 GGXXGGXIXXFXPPPXG--EXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXX 680 GG G P P G PPP +GG G G P P G GG Sbjct: 1128 GGLGGHQAPPAPPLPEGIGGVPPPPPVGGLG-GPPAPPPPAGFRGGTPPPNAH--GGVAP 1184 Query: 681 PPPPXXGGGXXXSPPHXXXGXXPPXXP 761 PPPP G G PP PP P Sbjct: 1185 PPPPPRGHGGVGGPPTPPGAPAPPMPP 1211 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/77 (33%), Positives = 28/77 (36%), Gaps = 4/77 (5%) Frame = +3 Query: 543 PPPXG--EXXPPPXLGG--GGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGGGX 710 PPP G PPP +GG G P P G GG PPPP G Sbjct: 1113 PPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPP-AGFRG 1171 Query: 711 XXSPPHXXXGXXPPXXP 761 PP+ G PP P Sbjct: 1172 GTPPPNAHGGVAPPPPP 1188 Score = 37.9 bits (84), Expect = 0.013 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 3/64 (4%) Frame = +3 Query: 543 PPPXGEXXPPPXLGGGGX-GXPXPXXXGXXXGXXXXXXXXXXGG-GXXPPPPXXGG-GXX 713 PP G PPP GG G P P G G G G PPPP GG G Sbjct: 1101 PPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGP 1160 Query: 714 XSPP 725 +PP Sbjct: 1161 PAPP 1164 Score = 35.9 bits (79), Expect = 0.051 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 3/73 (4%) Frame = +1 Query: 544 PPPXG--KXXPXPXXGG-GGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXX 714 PPP G P P GG GG P G GG G P G Sbjct: 1113 PPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGG 1172 Query: 715 XPPPTXXGGXXPP 753 PPP GG PP Sbjct: 1173 TPPPNAHGGVAPP 1185 Score = 35.5 bits (78), Expect = 0.067 Identities = 25/86 (29%), Positives = 26/86 (30%), Gaps = 5/86 (5%) Frame = +3 Query: 519 GGXIXXFXPPPXG-----EXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXP 683 GG PPP G + P P L G G P P G G GG P Sbjct: 1116 GGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPP 1175 Query: 684 PPPXXGGGXXXSPPHXXXGXXPPXXP 761 P G PP G P P Sbjct: 1176 PNAHGGVAPPPPPPRGHGGVGGPPTP 1201 Score = 33.9 bits (74), Expect = 0.20 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 6/85 (7%) Frame = -1 Query: 725 GGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGG 546 GG PPP G PP AP PPPPP G G Sbjct: 1079 GGIPPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLG------- 1131 Query: 545 GXKXXYXPPXXPXP------PPPPP 489 PP P P PPPPP Sbjct: 1132 ---GHQAPPAPPLPEGIGGVPPPPP 1153 Score = 33.9 bits (74), Expect = 0.20 Identities = 24/77 (31%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +3 Query: 543 PPPXGEXX---PPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPP-PPXXGGGX 710 PP G+ PPP +G G P P G G GG PP PP G Sbjct: 1089 PPTLGDYGVAPPPPSIGAGAP--PPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIG 1146 Query: 711 XXSPPHXXXGXXPPXXP 761 PP G P P Sbjct: 1147 GVPPPPPVGGLGGPPAP 1163 Score = 33.9 bits (74), Expect = 0.20 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 1/75 (1%) Frame = +1 Query: 544 PPPXG-KXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXP 720 P P G P P GG GG P G GG P P GG Sbjct: 1140 PLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGG--VGG 1197 Query: 721 PPTXXGGXXPPTXXG 765 PPT G PP G Sbjct: 1198 PPTPPGAPAPPMPPG 1212 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = -3 Query: 789 GXPPKXXXTXXXXGGXPPXXXGGGXXXXPPLXXGXGXFXPPPXXXPXXXXXXXXXXXXXX 610 G PP GG PP GG PP G G P P Sbjct: 1158 GGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGP----PTPPGAPAPPMPPGV 1213 Query: 609 GGGPPXPP 586 GGPP PP Sbjct: 1214 PGGPPPPP 1221 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = -3 Query: 783 PPKXXXTXXXXG-GXPPXXXGGGXXXXPPLXXGXGXFXPPPXXXPXXXXXXXXXXXXXXG 607 PP T G PP G G PP G PPP G Sbjct: 1085 PPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEG 1144 Query: 606 -GGPPXPPP 583 GG P PPP Sbjct: 1145 IGGVPPPPP 1153 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 1/85 (1%) Frame = -3 Query: 741 PPXXXGGGXXXXPPLXXGXGXFXPPPXXXPXXXXXXXXXXXXXXGGGPPXPPPXXR-XXX 565 PP G G PP G G PP P G PP PPP Sbjct: 1139 PPLPEGIGGVPPPPPVGGLGG--PPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVG 1196 Query: 564 XXXXXXXGKKXXFXPXKXXPPPPPP 490 P PPPPP Sbjct: 1197 GPPTPPGAPAPPMPPGVPGGPPPPP 1221 Score = 29.9 bits (64), Expect = 3.3 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 4/79 (5%) Frame = +2 Query: 668 GGXKXPXPXX--RGGXKXXPPPXXXGG--XPPXXXXVXXXXGGXPXXSPPQKXXXPPPXX 835 GG P P RGG PPP GG PP GG P +PP PP Sbjct: 1158 GGPPAPPPPAGFRGGT---PPPNAHGGVAPPPPPPRGHGGVGGPP--TPP--GAPAPPMP 1210 Query: 836 XKKKXXXPPPPSXKKXKXP 892 PPPP + P Sbjct: 1211 PGVPGGPPPPPGGRGLPAP 1229 Score = 29.1 bits (62), Expect = 5.8 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 3/83 (3%) Frame = +1 Query: 544 PPPXGKXXPXPXXGG-GGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPX--PXXXGGGXX 714 PP G P G G P G G GG + P P G G Sbjct: 1089 PPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGV 1148 Query: 715 XPPPTXXGGXXPPTXXGRXXFXG 783 PPP G PP F G Sbjct: 1149 PPPPPVGGLGGPPAPPPPAGFRG 1171 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +2 Query: 683 PXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPP 862 P P GG PP GG P G P + PPP PP Sbjct: 1140 PLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPP 1199 Query: 863 PP 868 P Sbjct: 1200 TP 1201 Score = 28.7 bits (61), Expect = 7.7 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 2/57 (3%) Frame = +1 Query: 262 PPQXVGGKFXXPQXKNFFXX*XPPPXXFWGX--PPXFLGGXXXPXPPXFXPXPXPPP 426 PP G P PPP G PP G P PP P PPP Sbjct: 1165 PPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPP 1221 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/103 (28%), Positives = 33/103 (32%) Frame = +3 Query: 384 PXXPPFXTXPXPPPLKRGKXCXXXXXXXXXFFXXFXGGGGGGGXXGGXIXXFXPPPXGEX 563 P P + P PP + C + GGGGGG G + PPP Sbjct: 49 PCNPSYYPPPPPPVVTPTPQCPPPPS--------YPSGGGGGGGGGTVMYTSPPPPYSGG 100 Query: 564 XPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPP 692 GGGG P P G G G PPPP Sbjct: 101 GGGSSTGGGGIYYPPPTGGGGGGGGGWQQGGGGGGAYPTPPPP 143 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = +1 Query: 544 PPPXGKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPP 723 P P P GGGGGG + GGGG GGG PP Sbjct: 65 PTPQCPPPPSYPSGGGGGGGGGTVMYT----SPPPPYSGGGGGSST-----GGGGIYYPP 115 Query: 724 PTXXGG 741 PT GG Sbjct: 116 PTGGGG 121 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPP G G + GGG Y P PPPP P Sbjct: 114 PPPTGGGGGGGGGWQQGGGGGGAY-----PTPPPPNP 145 Score = 28.7 bits (61), Expect = 7.7 Identities = 24/80 (30%), Positives = 26/80 (32%), Gaps = 5/80 (6%) Frame = +3 Query: 327 PPPXFXLGGPXXXFGGXKXPXXPPFXTXPXPPPLKRGKXCXXXXXXXXXFFXXFXGGGGG 506 PPP + GG GG P PPP G + GGGGG Sbjct: 71 PPPSYPSGGGGGGGGGTVMYTSP-------PPPYSGGGGGSSTGGGGIYYPPPTGGGGGG 123 Query: 507 G-----GXXGGXIXXFXPPP 551 G G GG PPP Sbjct: 124 GGGWQQGGGGGGAYPTPPPP 143 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 44.4 bits (100), Expect = 1e-04 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 5/92 (5%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXL----GGGGXGXPXPXXXGXXXGXXXXXXXX 659 GGGG G GG PP G PP L GGGG P G G Sbjct: 93 GGGGAPGPLGGG--GARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGG 150 Query: 660 XXGGGXXPPPPXXG-GGXXXSPPHXXXGXXPP 752 GGG PP G GG PP G P Sbjct: 151 GGGGGALARPPGGGRGGALGRPPGGGGGGGGP 182 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = +1 Query: 544 PPPXGKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPP 723 P P G P GGGGGG P G GGGG P GGG Sbjct: 98 PGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGAL 157 Query: 724 PTXXGG 741 GG Sbjct: 158 ARPPGG 163 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 3/77 (3%) Frame = -1 Query: 764 PXXVGGXXPPXXVGGGXXXP-PPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPP 588 P GG PP GGG PP G G PP P AP G Sbjct: 100 PLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALAR 159 Query: 587 PPXXGXGXXF--PXGGG 543 PP G G P GGG Sbjct: 160 PPGGGRGGALGRPPGGG 176 Score = 38.3 bits (85), Expect = 0.009 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 9/92 (9%) Frame = +3 Query: 492 GGGGGGGXX------GGXIXXFXPPPXGEXX---PPPXLGGGGXGXPXPXXXGXXXGXXX 644 GGGGGGG GG P P G P LGGGG G G G Sbjct: 110 GGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGAL 169 Query: 645 XXXXXXXGGGXXPPPPXXGGGXXXSPPHXXXG 740 GGG P GGG P G Sbjct: 170 GRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGG 201 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +1 Query: 574 PXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXG-GGXXXPPPTXXGGXXP 750 P GGGGG P GA GGGG P G GG PP GG Sbjct: 122 PGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGG 181 Query: 751 P 753 P Sbjct: 182 P 182 Score = 35.9 bits (79), Expect = 0.051 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +1 Query: 556 GKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPPPTXX 735 G P GGGGGG P G GG G P GGG P Sbjct: 128 GGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPG 187 Query: 736 GG 741 GG Sbjct: 188 GG 189 Score = 35.5 bits (78), Expect = 0.067 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG GG G P GGG G G G G Sbjct: 296 GGGGGGGGGGG---------GGHGAPELGFSGGGGG----GGGGEIAGTVDLRGGGGGAG 342 Query: 672 GXXPPPPXXGGG 707 G PP P GGG Sbjct: 343 GVFPPTPDLGGG 354 Score = 34.7 bits (76), Expect = 0.12 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +1 Query: 556 GKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPPPTXX 735 G P GGGGGG G GGGG P GGG P Sbjct: 140 GGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAP 199 Query: 736 GG 741 GG Sbjct: 200 GG 201 Score = 33.5 bits (73), Expect = 0.27 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +1 Query: 547 PPXGKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPPP 726 PP G P P GGGG P G GGGG P GGG P Sbjct: 91 PPGGGGAPGPL--GGGGARP--PGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRR 146 Query: 727 TXXGG 741 GG Sbjct: 147 VLGGG 151 Score = 33.1 bits (72), Expect = 0.36 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 2/72 (2%) Frame = +1 Query: 556 GKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGX--KXPXPXXXGGGXXXPPPT 729 G P P GGGGG GA G GG + P GGG P Sbjct: 129 GARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGG 188 Query: 730 XXGGXXPPTXXG 765 GG P G Sbjct: 189 GGGGGGPGRAPG 200 Score = 31.9 bits (69), Expect = 0.82 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG + G PP G GG P G G GG Sbjct: 136 GGGGGGGAPRRVLGGGGG--GGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGG 193 Query: 672 GXXPPPPXXGGG 707 G P GGG Sbjct: 194 GPGRAPGGGGGG 205 Score = 31.5 bits (68), Expect = 1.1 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 6/80 (7%) Frame = +3 Query: 486 FXGGGGGGGXXGGXIXXFXP------PPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXX 647 F GGGGGGG GG I G P P LGGGG G Sbjct: 316 FSGGGGGGG--GGEIAGTVDLRGGGGGAGGVFPPTPDLGGGGGGGGGGTKV-RVCAPKDI 372 Query: 648 XXXXXXGGGXXPPPPXXGGG 707 GGG P GGG Sbjct: 373 SGGGGGGGGMLDKPDEAGGG 392 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 583 GGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPPPTXXGG 741 GGGGGG GA GGGG GGG P GG Sbjct: 150 GGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGG 202 Score = 30.3 bits (65), Expect = 2.5 Identities = 25/102 (24%), Positives = 27/102 (26%) Frame = +2 Query: 497 GGGGXXFXGXNXXFXPPPPXGNXPPXLSXXXXXXXXXXXXXXXXXXXXXXXXGXXXGGGX 676 GGGG G PP + PP G GG Sbjct: 102 GGGGARPPGGGGGGGPP----SLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGAL 157 Query: 677 KXPXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXXSP 802 P RGG PP GG P GG P +P Sbjct: 158 ARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAP 199 Score = 30.3 bits (65), Expect = 2.5 Identities = 25/75 (33%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXL---GGGGXGXPXPXXXGXXXGXXXXXXXXX 662 GGGGGGG GG GE P + GGGG G G G Sbjct: 200 GGGGGGGGLGGG--------GGEGGAPERVIGGGGGGGGALKCVVGGGGGGGGALKRAAG 251 Query: 663 XGGGXXPPPPXXGGG 707 GGG GGG Sbjct: 252 SGGGGGALECEIGGG 266 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 661 GGGGXKXPXPXXXGGGXXXPPPTXXGGXXPPTXXGRXXFXGXP 789 GGGG + P GG PP GG P G G P Sbjct: 102 GGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAP 144 Score = 29.5 bits (63), Expect = 4.4 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -3 Query: 867 GGGGXXFFFFXXXGGGXXFFCGGEXXGXPPKXXXTXXXXGGX-PPXXXGGGXXXXPPLXX 691 GGGG GGG GG G PP GG PP GGG P Sbjct: 93 GGGGAP----GPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVL 148 Query: 690 GXG 682 G G Sbjct: 149 GGG 151 Score = 29.1 bits (62), Expect = 5.8 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG G P G P GGG G G G GG Sbjct: 174 GGGGGGGGPGRA-----PGGGGGGGGPGRAPGGGGGGGGLGGGGGEGGAPERVIGGGGGG 228 Query: 672 GXXPPPPXXGGG 707 G GGG Sbjct: 229 GGALKCVVGGGG 240 Score = 28.7 bits (61), Expect = 7.7 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 556 GKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGG 708 G P P GGGGGG GGGG P GGG Sbjct: 343 GVFPPTPDLGGGGGGG-GGGTKVRVCAPKDISGGGGGGGGMLDKPDEAGGG 392 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPP AP PPPPPP G P PP P PPPPP Sbjct: 314 PPPPPPKPAAAAPPPPPPPK--AAPPPPPPK---GPPPPPPAKGPPPPPPPKGPSPPPPP 368 Query: 491 PKXXKK 474 P KK Sbjct: 369 PPGGKK 374 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXX-GXPPPPPPXXGXGXXFPXGGGXKXX 531 PPP PPPP P G PPPPPP P GG K Sbjct: 317 PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKG- 375 Query: 530 YXPPXXPXPPPPPPK 486 PPPPPPK Sbjct: 376 -------GPPPPPPK 383 Score = 36.7 bits (81), Expect = 0.029 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P K PP PPPPPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 35.9 bits (79), Expect = 0.051 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +2 Query: 683 PXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPP 862 P P PPP PP P PP K PPP PP Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPK-------GPPPPPPAKGPPPPPPPKGPSPPPPP 368 Query: 863 PPSXKKXKXP 892 PP KK P Sbjct: 369 PPGGKKGGPP 378 Score = 35.9 bits (79), Expect = 0.051 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +2 Query: 710 KXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPPSXK 877 K PPP G PP G P PP+ PPP K PPPP K Sbjct: 333 KAAPPPPPPKGPPPPPPAK-----GPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPK 383 Score = 35.1 bits (77), Expect = 0.088 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXG 573 PPP G PPPP P G PPPPPP G Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPPPPPPPGGKK---GGPPPPPPKGG 385 Score = 33.1 bits (72), Expect = 0.36 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 719 PPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXK--KKXXXPPPP 868 PPP PP P PP K PPP KK PPPP Sbjct: 330 PPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 328 PPPXXFWGXPPXFLGGXXXPXPPXFXPXPXPPPLKG 435 PPP G PP P PP P P PPP G Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPG 371 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +3 Query: 543 PPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGGGXXXSP 722 PPP G PPP G P P GG PPPP G + Sbjct: 339 PPPKGPPPPPPAKG------PPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAA 392 Query: 723 PHXXXG 740 P G Sbjct: 393 PGVPTG 398 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/75 (26%), Positives = 20/75 (26%), Gaps = 2/75 (2%) Frame = +3 Query: 543 PPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGG--GXXX 716 P P PPP P P G PPPP GG G Sbjct: 319 PKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPP 378 Query: 717 SPPHXXXGXXPPXXP 761 PP PP P Sbjct: 379 PPPPKGGASRPPAAP 393 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/73 (26%), Positives = 19/73 (26%) Frame = +3 Query: 543 PPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGGGXXXSP 722 PPP PPP P P G PPPP G P Sbjct: 313 PPPP----PPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPP 368 Query: 723 PHXXXGXXPPXXP 761 P PP P Sbjct: 369 PPGGKKGGPPPPP 381 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 782 PXXXXRPXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPP 660 P P G PP G PPP G PPPP Sbjct: 341 PKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 328 PPPXXFWGXPPXFLGGXXXPXPPXFXPXPXPPPLKGE 438 PPP PP G P PP P PPP G+ Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGK 373 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 764 PXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPP 660 P G PP G PPP G PPPP Sbjct: 348 PPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 43.2 bits (97), Expect = 3e-04 Identities = 30/91 (32%), Positives = 30/91 (32%), Gaps = 7/91 (7%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPP---PXXGX 570 PP GG PPP PPPP P PPPPP P Sbjct: 11 PPPPQGGFPPQPPPM----NPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPH 66 Query: 569 GXXFPXGGGXKXXYXPPXXP----XPPPPPP 489 F G G PP P PPPPPP Sbjct: 67 QPQFNFGPGPPQQQQPPPPPQMYYQPPPPPP 97 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP P PP P PPPPPP G P Sbjct: 62 PPPPHQPQFNFGPGPPQQQQPPPPPQMYYQ------PPPPPPPYGVNSSQPPPPPPPPPS 115 Query: 527 XPPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 116 PPPSAPPPPPPPP 128 Score = 37.9 bits (84), Expect = 0.013 Identities = 23/86 (26%), Positives = 25/86 (29%) Frame = +2 Query: 722 PPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPPSXKKXKXPLXX 901 PP GG PP + G P P PPP PPPP P Sbjct: 11 PPPPQGGFPPQPPPMNPY--GPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQP 68 Query: 902 XXXXXXXXXXXKXXXPPPLXXXXPPP 979 + PPP PPP Sbjct: 69 QFNFGPGPPQQQQPPPPPQMYYQPPP 94 Score = 37.1 bits (82), Expect = 0.022 Identities = 27/92 (29%), Positives = 27/92 (29%), Gaps = 5/92 (5%) Frame = -1 Query: 749 GXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXG-----XPPPPP 585 G PP G PP PPPP P G PPPPP Sbjct: 29 GPPPPQQPAYGHMPPPQGAPPPFLAPPPPP--PPGPPPPHQPQFNFGPGPPQQQQPPPPP 86 Query: 584 PXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 P G PP P PP PPP Sbjct: 87 QMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPP 118 Score = 36.3 bits (80), Expect = 0.038 Identities = 24/89 (26%), Positives = 25/89 (28%), Gaps = 4/89 (4%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXX----PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXG 573 PP G P G G PPPP P PPPPPP Sbjct: 56 PPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPS 115 Query: 572 XGXXFPXGGGXKXXYXPPXXPXPPPPPPK 486 P PP PPPP+ Sbjct: 116 PPPSAPPPPPPPPTQPPPREAQLAPPPPR 144 Score = 34.3 bits (75), Expect = 0.15 Identities = 24/87 (27%), Positives = 26/87 (29%) Frame = +2 Query: 719 PPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPPSXKKXKXPLX 898 PPP G PP G PPQ+ PPP + PPPP P Sbjct: 55 PPPPPPGPPPPHQPQFNFGPG------PPQQQQPPPPPQMYYQPPPPPPPYGVNSSQP-- 106 Query: 899 XXXXXXXXXXXXKXXXPPPLXXXXPPP 979 PPP PPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPPP 133 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP PPPP P PPPPPP P Sbjct: 552 PPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPI 611 Query: 527 XPPXXPXPPPPPP 489 P PPPPPP Sbjct: 612 LPNRSVPPPPPPP 624 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P G K + PP P PPPPPP Sbjct: 544 PPPPPPPP------PPPSGNKPAFSPPPPPPPPPPPP 574 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/84 (29%), Positives = 26/84 (30%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 PP + PPP PPP P PPPPPP Sbjct: 623 PPPPLPNHSVLPPPPPP-----PPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSR 677 Query: 560 FPXGGGXKXXYXPPXXPXPPPPPP 489 P G PP P PPP PP Sbjct: 678 TPTGAATSSKGPPP--PPPPPLPP 699 Score = 38.7 bits (86), Expect = 0.007 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 3/76 (3%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP G PPP P PPPPPP P Sbjct: 550 PPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVP--SPPPPPP 607 Query: 527 XPPXXP---XPPPPPP 489 PP P PPPPPP Sbjct: 608 PPPILPNRSVPPPPPP 623 Score = 36.3 bits (80), Expect = 0.038 Identities = 20/73 (27%), Positives = 20/73 (27%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 P P PPPP P PPPP P P Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPL 594 Query: 527 XPPXXPXPPPPPP 489 P PPPPPP Sbjct: 595 PNCLVPSPPPPPP 607 Score = 36.3 bits (80), Expect = 0.038 Identities = 23/74 (31%), Positives = 24/74 (32%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP PPPP P PPPPPP P Sbjct: 608 PPPILPNRSVPPPPPPP-------PPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGN 660 Query: 527 XPPXXPXPPPPPPK 486 P P PPPPPP+ Sbjct: 661 KFPAPP-PPPPPPR 673 Score = 33.9 bits (74), Expect = 0.20 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP G P PP P P PPPP G P Sbjct: 718 PPPANRSNGPSAPAPPLP------PPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQA 771 Query: 527 XPPXXPXPPPPP 492 P PPPPP Sbjct: 772 PKPPGTVPPPPP 783 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 6/72 (8%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPP------XXP 510 PPPP A PPPPPP P P P Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPP 748 Query: 509 XPPPPPPKXXKK 474 PPPPP KK Sbjct: 749 APPPPPLMTGKK 760 Score = 29.9 bits (64), Expect = 3.3 Identities = 24/98 (24%), Positives = 26/98 (26%), Gaps = 7/98 (7%) Frame = +2 Query: 710 KXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPP-------XXXKKKXXXPPPP 868 K P PP G P SPP PPP + PPPP Sbjct: 533 KLPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Query: 869 SXKKXKXPLXXXXXXXXXXXXXKXXXPPPLXXXXPPPL 982 P + PPP PPPL Sbjct: 593 PLPNCLVPSPPPPPPPPPILPNRSVPPPP---PPPPPL 627 Score = 28.7 bits (61), Expect = 7.7 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 719 PPPXXXGGXP--PXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPPSXKKXKXP 892 PPP P P +PP PPP KK PPPP + K P Sbjct: 718 PPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPP--PPPLMTGKKAPAPPPPPPQAPKPP 775 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 6/85 (7%) Frame = -1 Query: 737 PXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGX-PPPPPPXXGXGXX 561 P GG PPP PPPP P G PPPPPP G Sbjct: 258 PNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPP 317 Query: 560 F-----PXGGGXKXXYXPPXXPXPP 501 P GG + P P PP Sbjct: 318 RSIPPPPMTGGAMANFTPGAPPRPP 342 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P G + P PPPPPP Sbjct: 280 PPPPPPNA------PMGMPPRIPPPPVGGTQPPPPPP 310 Score = 22.6 bits (46), Expect(3) = 2.4 Identities = 11/32 (34%), Positives = 11/32 (34%) Frame = +2 Query: 332 PPLXFGGXXXXFWGDXXXPXPPXLXPPPXPPP 427 PP G G P P PPP PP Sbjct: 250 PPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPP 281 Score = 22.6 bits (46), Expect(3) = 2.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 542 PPPPXGNXPP 571 PPPP N PP Sbjct: 308 PPPPLANGPP 317 Score = 21.8 bits (44), Expect(3) = 2.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +2 Query: 683 PXPXXRGGXKXXPPPXXXGG 742 P P G + PPP GG Sbjct: 309 PPPLANGPPRSIPPPPMTGG 328 >01_05_0490 + 22672241-22674679 Length = 812 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY--XPPXXPXPPP 498 PPPP P PPPPPP +P Y PP P PPP Sbjct: 643 PPPPPTTRRSRKPPQPPSRPA---PPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPP 699 Query: 497 PPP 489 PPP Sbjct: 700 PPP 702 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXKK 474 PPPPPP F GG P PPPPPP ++ Sbjct: 610 PPPPPPSSIFYNLFKKGGSKSRRIHSVAPPQPPPPPPPTTRR 651 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP GG K P PPPPP Sbjct: 609 PPPPPPPSSIFYNLFKKGGSKSRRIHSVAPPQPPPPP 645 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPP-PPPPK 486 PPPPPP P + PP P PP PPPP+ Sbjct: 641 PPPPPP--------PTTRRSRKPPQPPSRPAPPPPPPPQ 671 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = +2 Query: 677 KXPXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXX 856 K P P R PPP P V P SPP PPP + Sbjct: 654 KPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTY-PLPPPSPPLPPPPPPPPPPMSEGEE 712 Query: 857 PPPPSXKKXKXP 892 PPS P Sbjct: 713 EAPPSVTASPAP 724 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/83 (33%), Positives = 28/83 (33%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 P G G PPP PPPP AP G PPPPPP Sbjct: 310 PGAGAGAGTGAPPPPPAHPAAPAPPPP-------APSPSAAGAGSG-PPPPPPPAAPAAP 361 Query: 560 FPXGGGXKXXYXPPXXPXPPPPP 492 P G G P PPPPP Sbjct: 362 RPPGPG----------PGPPPPP 374 Score = 35.1 bits (77), Expect = 0.088 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 P P G G PPPP AP PPPPP G G GGG Sbjct: 338 PSPSAAGAGSGPPPPPPPA----APAAPRPPGPGPGPPPPPGAAGRG-----GGGPPPPA 388 Query: 527 XPPXXPXPPPPPPK 486 P PPP K Sbjct: 389 LPGGPRARGPPPFK 402 Score = 33.5 bits (73), Expect = 0.27 Identities = 35/133 (26%), Positives = 36/133 (27%), Gaps = 14/133 (10%) Frame = +3 Query: 369 GGXKXPXXPPFXTXPXPP---PLKRGKXCXXXXXXXXXFFXXFXGGGGGGGXXGGXIXXF 539 GG + P PP P PP PL G G G G Sbjct: 268 GGGQVPAAPPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLP-PGAGAGAGTGAPPPPPA 326 Query: 540 XP--PPXGEXXPPPXLGGGGXGXPXPXXX---------GXXXGXXXXXXXXXXGGGXXPP 686 P P P P G G G P P G G GGG PP Sbjct: 327 HPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPP 386 Query: 687 PPXXGGGXXXSPP 725 P GG PP Sbjct: 387 PALPGGPRARGPP 399 Score = 32.7 bits (71), Expect = 0.47 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPP P G PPPP G G G PP P P PP Sbjct: 277 PPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAG--AGAGTGAPPPPPAHPAAPAPP 334 Query: 491 P 489 P Sbjct: 335 P 335 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/113 (22%), Positives = 27/113 (23%), Gaps = 3/113 (2%) Frame = +2 Query: 542 PPPPXGNXPPXLSXXXXXXXXXXXXXXXXXXXXXXXXGXXXGGGXKXPXPXXRGGXKXXP 721 PPPP G PP G G G P P P Sbjct: 276 PPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPP 335 Query: 722 P---PXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPPS 871 P P G P P PPP + PPPP+ Sbjct: 336 PAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPA 388 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/86 (27%), Positives = 26/86 (30%), Gaps = 1/86 (1%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXA-PXXXXXXXXXGXPPPPPPXXGXGX 564 P G P G PPPP + P PPPPPP Sbjct: 182 PSSSAGASSSMPGTEEAGPSTLPPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPAN 241 Query: 563 XFPXGGGXKXXYXPPXXPXPPPPPPK 486 G PP P PP PPP+ Sbjct: 242 I----AGAPGLPLPPPPPPPPGPPPR 263 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PP G P P + PPPPPP P Sbjct: 168 PPMYKSSIGPRIPLPSSSAGASSSMPGTEEAGPSTLPPPPPPPPLPASSEPVDPSAASL- 226 Query: 527 XPPXXPXPPPPPPK 486 P P PPPPPPK Sbjct: 227 --PPLPPPPPPPPK 238 Score = 29.9 bits (64), Expect = 3.3 Identities = 23/85 (27%), Positives = 25/85 (29%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 PP + P PPPP P G P PPPP Sbjct: 208 PPPPLPASSEPVDPSAASLPPLPPPPPPP------PKPANIAGAPGLPLPPPPP------ 255 Query: 560 FPXGGGXKXXYXPPXXPXPPPPPPK 486 P G P PPPPPP+ Sbjct: 256 -PPPGPPPREIVPGQTLLPPPPPPR 279 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 328 PPPXXFWGXPPXFLGGXXXPXPPXFXPXPXPPP 426 PPP P G P PP P P PPP Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 Score = 28.7 bits (61), Expect = 7.7 Identities = 27/97 (27%), Positives = 28/97 (28%), Gaps = 3/97 (3%) Frame = -1 Query: 782 PXXXXRPXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXG 603 P RP + P G PPP PPPP AP Sbjct: 358 PPLPPRPPTMPSMQPDMLAPGVPRFPPP---------PPPPDTRPPFMAPGVNARPL--- 405 Query: 602 XPPPP---PPXXGXGXXFPXGGGXKXXYXPPXXPXPP 501 PPPP PP F G PP P PP Sbjct: 406 -PPPPPGLPPAQMQMAPFGVPPGPPPMLPPPFYPGPP 441 >07_01_0080 + 587674-588510 Length = 278 Score = 37.5 bits (83), Expect = 0.017 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P G PP P PPPPPP Sbjct: 91 PPPPPPPP------PSSGSPPPPPPPPPPPPPPPPPP 121 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = -1 Query: 725 GGGXXXPPPXXXGXGXXX--PPPPXXXXXXXAPXXXXXXXXXGXPPPPPP 582 G PP G G PPPP +P PPPPPP Sbjct: 72 GAASTSTPPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 328 PPPXXFWGXPPXFLGGXXXPXPPXFXPXPXPPP 426 PPP PP G P PP P P PPP Sbjct: 91 PPPPP---PPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 328 PPPXXFWGXPPXFLGGXXXPXPPXFXPXPXPPPL 429 PPP G PP P PP P P PPPL Sbjct: 95 PPPPPSSGSPPP------PPPPPPPPPPPPPPPL 122 >12_02_1174 - 26696869-26698191 Length = 440 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P PP P PPPPPP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPP 160 Score = 35.9 bits (79), Expect = 0.051 Identities = 24/84 (28%), Positives = 24/84 (28%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 PP PPP P PP P PPPPP Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSV 201 Query: 560 FPXGGGXKXXYXPPXXPXPPPPPP 489 P K PP P P PPPP Sbjct: 202 KPPVVQPKPQ-PPPTLPPPSPPPP 224 Score = 34.7 bits (76), Expect = 0.12 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = -1 Query: 704 PPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYX 525 PP PPPP P PPP P P G Sbjct: 181 PPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVPPRTPGDTPAVV 240 Query: 524 PPXXPXPPPPPPKXXKK 474 P P PPPPPP+ K Sbjct: 241 EPK-PQPPPPPPRAPVK 256 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP PP P PPPPPP P K Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPR--PPSVKPPVVQPKPQP 181 Query: 527 XPPXXPXPPPPPP 489 P P PPPPP Sbjct: 182 PPSLQPPSPPPPP 194 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 600 PPXPPPXXRXXXXXXXXXXGKKXXFXPXKXXPPPPPP 490 PP PPP R K P PPPPPP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPP 160 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPP 495 PPPP P P PPPP P K PP P PPPP Sbjct: 221 PPPPPPTVPPRTPGDTPAVVEP-KPQPPPPPPRAPVKMPRVLEPKPS-PPPPSPLPPPP 277 >05_01_0141 - 937428-937717,938483-938705 Length = 170 Score = 37.1 bits (82), Expect = 0.022 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLG-GGGXGXPXPXXXG 623 GGGGG G + PPP PPP G GGG G P G Sbjct: 23 GGGGGHGYPYPPQQGYYPPPPTAYPPPPPAGYGGGYGYPPAGYPG 67 >09_02_0495 + 9880714-9881196 Length = 160 Score = 36.7 bits (81), Expect = 0.029 Identities = 25/77 (32%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGX----PPPPPPXXGXGXXFPXGGGX 540 PPP G PPPP + G PPPPP G P GG Sbjct: 39 PPPIAGGAVNSYPPPPPAGSSSSSSSGGGDGGAGGLFGGTYPPPPPGVMPGAFAPPFGGG 98 Query: 539 KXXYXPPXXPXPPPPPP 489 P P PPPP P Sbjct: 99 F-----PYGPAPPPPNP 110 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/67 (29%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +3 Query: 417 PPPLKRGKXCXXXXXXXXXFFXXFXGGGGGGGXXGGXIXXFXPPPXGEXXP--PPXLGGG 590 PPP+ G GGG GG G + PPP G P GGG Sbjct: 39 PPPIAGGAVNSYPPPPPAGSSSSSSSGGGDGGAGGLFGGTYPPPPPGVMPGAFAPPFGGG 98 Query: 591 GXGXPXP 611 P P Sbjct: 99 FPYGPAP 105 Score = 28.7 bits (61), Expect = 7.7 Identities = 19/68 (27%), Positives = 20/68 (29%), Gaps = 3/68 (4%) Frame = +3 Query: 567 PPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXG---GGXXPPPPXXGGGXXXSPPHXXX 737 PPP GG P P G G GG PPPP +PP Sbjct: 39 PPPIAGGAVNSYPPPPPAGSSSSSSSGGGDGGAGGLFGGTYPPPPPGVMPGAFAPPFGGG 98 Query: 738 GXXPPXXP 761 P P Sbjct: 99 FPYGPAPP 106 >02_05_0149 + 26290236-26290880 Length = 214 Score = 36.3 bits (80), Expect = 0.038 Identities = 24/72 (33%), Positives = 25/72 (34%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG GG + G P GGGG G G GG Sbjct: 102 GGGGGGGGGGGSGRAYG-FGGGYGGHPGGFGGGGGGGGGGGGRNYGGGSGGIGGYGNYGG 160 Query: 672 GXXPPPPXXGGG 707 G P GGG Sbjct: 161 GYNGEPGGGGGG 172 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 35.9 bits (79), Expect = 0.051 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP PP P PPPPPP Sbjct: 371 PPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 35.5 bits (78), Expect = 0.067 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPPPP G G G G + P PPPPP Sbjct: 12 PPPPPPPFGRGG---GGAGYPRGHKQLYAPPPPPPP 44 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 35.1 bits (77), Expect = 0.088 Identities = 24/93 (25%), Positives = 26/93 (27%) Frame = -1 Query: 767 RPXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPP 588 RP PP + PPP PPPP +P PP P Sbjct: 17 RPTPAPQATPPPAIPESGPPPPP-----APDMPPPPPTPAPQSSPAPPPAPDMT-PPPGP 70 Query: 587 PPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 P P P PPPPPP Sbjct: 71 GPAAAPSPHSPSPSNAPWVAPAADIPPPPPPPP 103 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/87 (25%), Positives = 23/87 (26%), Gaps = 3/87 (3%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXP---PPPPPXXGX 570 PP PPP G PP P P P PPP P Sbjct: 15 PPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAA 74 Query: 569 GXXFPXGGGXKXXYXPPXXPXPPPPPP 489 + P PPPPPP Sbjct: 75 APSPHSPSPSNAPWVAPAADIPPPPPP 101 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 35.1 bits (77), Expect = 0.088 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 1/93 (1%) Frame = -1 Query: 764 PXXVGGXXPPXXVGGGXXX-PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPP 588 P GG P G PPP G PPP P G PP Sbjct: 246 PPRGGGAIPGLPAGFPFLLRPPPPLPVPGVICRPPPSPPYFAPPPRATPTVSLAGPPPGF 305 Query: 587 PPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 P G G G P PPPPPP Sbjct: 306 NPKRGL-----IGRGEAITLPESERPTPPPPPP 333 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 35.1 bits (77), Expect = 0.088 Identities = 26/79 (32%), Positives = 26/79 (32%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG GG G GGGG G G G GG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGG-----GGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 89 Query: 672 GXXPPPPXXGGGXXXSPPH 728 G PP GG P H Sbjct: 90 GGGYYPPWNGGYYPPGPGH 108 Score = 33.1 bits (72), Expect = 0.36 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +1 Query: 583 GGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPPPTXXGGXXPP 753 GGGGGG G GGGG GGG P GG PP Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPP 104 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 583 GGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPPPTXXGGXXPPTXX 762 GGGGGG G GGGG GGG GG PP Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNG 99 Query: 763 G 765 G Sbjct: 100 G 100 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 599 PPPPPPXX---GXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP G P PP P PPPPPP Sbjct: 11 PPPPPPQLEASGSDPDDPLLRDRVVVIAPPPPPPPPPPPP 50 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 34.7 bits (76), Expect = 0.12 Identities = 24/90 (26%), Positives = 25/90 (27%) Frame = -1 Query: 764 PXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPP 585 P V G PP PP PP AP G PPPPP Sbjct: 19 PPQVSGAPPPPHGHYQQQPPPQPYCQQQQPLPPHYYQAGPPHAPPPQQPPAMWGQPPPPP 78 Query: 584 PXXGXGXXFPXGGGXKXXYXPPXXPXPPPP 495 P + PP PPPP Sbjct: 79 PQYAPPPPQQFQLPHQQYAPPPQHYAPPPP 108 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/85 (25%), Positives = 24/85 (28%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 PP + GG PP G PPPP P PP Sbjct: 5 PPPTMNGGHHAAPPPPQVSG--APPPPHGHYQQQPPPQPYCQQQQPLPPHYYQAGPPHAP 62 Query: 560 FPXGGGXKXXYXPPXXPXPPPPPPK 486 P PP P PPPP+ Sbjct: 63 PPQQPPAMWGQPPPPPPQYAPPPPQ 87 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/60 (26%), Positives = 21/60 (35%) Frame = +2 Query: 800 PPQKXXXPPPXXXKKKXXXPPPPSXKKXKXPLXXXXXXXXXXXXXKXXXPPPLXXXXPPP 979 PPQ PPP + PP P ++ + PL PP + PPP Sbjct: 19 PPQVSGAPPPPHGHYQQQPPPQPYCQQ-QQPLPPHYYQAGPPHAPPPQQPPAMWGQPPPP 77 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 34.7 bits (76), Expect = 0.12 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 P P P PP A G PPPPPP G P G Sbjct: 387 PQPAVPPGPPAVPAPPTYPPADPAAGGYTSQPYMGAPPPPPP--GSYAPVPWG------Q 438 Query: 527 XPPXXPXPPPPP 492 PP PPPPP Sbjct: 439 PPPYASYPPPPP 450 >01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536, 7878507-7878761 Length = 223 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLG 584 GGGGGGG GG F PP PP +G Sbjct: 16 GGGGGGGGGGGEYGTFQGPPSYPPPRPPVVG 46 >04_03_0803 - 19835284-19836050,19836337-19836418 Length = 282 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPP-XXPXPPPP 495 PPPPPP G GG + PP P PPPP Sbjct: 226 PPPPPPSRCGGCGHGDCGGWCGGHRPPINCPAPPPP 261 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPP 495 PPPPPP G GG P P PPPP Sbjct: 197 PPPPPPSRCGGCDHADCGGWCGGQPPINCPPPPPP 231 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 329 PPPLXFGGXXXXFWGDXXXPXPPXLXPPPXPP 424 PPP GG G PP PPP PP Sbjct: 200 PPPSRCGGCDHADCGGWCGGQPPINCPPPPPP 231 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/70 (24%), Positives = 22/70 (31%) Frame = +2 Query: 683 PXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPP 862 P P + + PP PP + P P PPP K+ PP Sbjct: 183 PEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPPKKEPPPPPPPKQEPCPP 242 Query: 863 PPSXKKXKXP 892 PP + P Sbjct: 243 PPKVVEVPYP 252 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/60 (26%), Positives = 20/60 (33%) Frame = +2 Query: 800 PPQKXXXPPPXXXKKKXXXPPPPSXKKXKXPLXXXXXXXXXXXXXKXXXPPPLXXXXPPP 979 PP P P KK+ PPPP ++ P + PP PPP Sbjct: 174 PPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPPKKEPPPPP 233 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPP----PPPXXGXGXXFPXGGGXKXXYXPPXXPXP 504 PPPP P PP P P P + PP P Sbjct: 171 PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPPKKEPP 230 Query: 503 PPPPPK 486 PPPPPK Sbjct: 231 PPPPPK 236 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/64 (26%), Positives = 22/64 (34%) Frame = +2 Query: 788 PXXSPPQKXXXPPPXXXKKKXXXPPPPSXKKXKXPLXXXXXXXXXXXXXKXXXPPPLXXX 967 P PP+K P P K++ PPP+ + P PPP Sbjct: 181 PEPEPPKKE-EPQPPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPPKKEPPPPPPPKQEP 239 Query: 968 XPPP 979 PPP Sbjct: 240 CPPP 243 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 33.9 bits (74), Expect = 0.20 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +3 Query: 543 PPPXGEXXP-PPXLGG--GGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGGG 707 PP G P PP GG GG G P G G GGG PPP GGG Sbjct: 351 PPSYGAPPPNPPYSGGAPGGQGSLPPSYDGGYGG-----RPMPGGGGPGAPPPYHGGG 403 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +1 Query: 544 PPPXGKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGG 708 PP G P P GG G G GGGG P P GGG Sbjct: 351 PPSYGAPPPNPPYSGGAPGG-QGSLPPSYDGGYGGRPMPGGGGPGAPPPYHGGGG 404 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG GG + G GGGG G G G GG Sbjct: 55 GGGGGGGYGGGGVG------GGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGG 108 Query: 672 G 674 G Sbjct: 109 G 109 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPP---XXPXPPPPPP 489 PP PPP FP + PP P PPPPPP Sbjct: 286 PPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPP 325 Score = 31.5 bits (68), Expect = 1.1 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 8/80 (10%) Frame = -1 Query: 704 PPXXXGXGXXXPPPPXXXXXXXA---PXXXXXXXXXGXPPPPPPXXGXGXX----FPXGG 546 PP P PP A P PPPPPP P Sbjct: 252 PPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFP 311 Query: 545 GXKXXYX-PPXXPXPPPPPP 489 Y PP P PPPPPP Sbjct: 312 PLPSFYPSPPPPPPPPPPPP 331 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +1 Query: 295 PQXKNFFXX*XPPPXXFWGXPPXFLGGXXXPXPPXFXPXPXPPP 426 P +F+ PPP PP F P P F P P PPP Sbjct: 311 PPLPSFYPSPPPPPPPPPPPPPSF-PWPFPPLAPLFPPYPSPPP 353 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 719 PPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPP 868 PPP G PP P PP PPP PPPP Sbjct: 1138 PPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPP 1187 Score = 32.3 bits (70), Expect = 0.62 Identities = 22/73 (30%), Positives = 23/73 (31%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP PP P P PPPPPP P G + Sbjct: 1146 PPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPP-------LPSGPPPQPA- 1197 Query: 527 XPPXXPXPPPPPP 489 PP P PPP P Sbjct: 1198 -PPPLPIQPPPIP 1209 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPP 582 PPP PPPP P PP PPP Sbjct: 1170 PPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPP 1211 >12_01_0399 + 3152219-3152721,3152995-3153127,3155013-3155097, 3155321-3155586 Length = 328 Score = 33.1 bits (72), Expect = 0.36 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +3 Query: 384 PXXPPFXTXPXPPPLKRGKXCXXXXXXXXXFFXXFX----GGGGGGGXXGG 524 P PP P P P G FF F GGGGGGG GG Sbjct: 65 PPPPPMAATPAPAPRPPGGAHMRSLSLDTAFFEGFSLQGGGGGGGGGGSGG 115 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 33.1 bits (72), Expect = 0.36 Identities = 24/79 (30%), Positives = 25/79 (31%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 PP + PPP G PPP AP G PPPP G Sbjct: 625 PPPMMANAAPVPPP-SMANGAGPVPPPIAVAPPPAP------PIAGAAPPPPMANGAAAA 677 Query: 560 FPXGGGXKXXYXPPXXPXP 504 P GG PP P P Sbjct: 678 APPGGNP----APPAGPQP 692 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/71 (26%), Positives = 19/71 (26%) Frame = -1 Query: 704 PPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYX 525 PP PPP P PPP PP G P G Sbjct: 625 PPPMMANAAPVPPPSMANGAGPVPPPIAVA-----PPPAPPIAGAAPPPPMANGAAAAAP 679 Query: 524 PPXXPXPPPPP 492 P P PP P Sbjct: 680 PGGNPAPPAGP 690 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 545 GXKXXYXPPXXPXPPPPPP 489 G + PP P PPPPPP Sbjct: 542 GEEGLVGPPPPPPPPPPPP 560 Score = 25.0 bits (52), Expect(3) = 0.80 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPP P Sbjct: 551 PPPPPPPPPPAP 562 Score = 23.0 bits (47), Expect(3) = 0.80 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 548 GPPPPPPP 555 Score = 20.6 bits (41), Expect(3) = 0.80 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = -1 Query: 725 GGGXXXPPPXXXGXGXXXPPPP 660 GGG P G PPPP Sbjct: 533 GGGIAIGPLGEEGLVGPPPPPP 554 >04_03_1022 - 21778315-21779007 Length = 230 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPP P PPPPPP P + Y P PP P Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPPPPPYVPPHLLPPSPAPQQWYDHPPNYHPPHTP 75 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 33.1 bits (72), Expect = 0.36 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPP--PPPP 489 PPPPPP G G G + + P P PP PPPP Sbjct: 217 PPPPPPCGCSGGHGNCGCGIR-PWPPQVWPPPPVCPPPP 254 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PP PPP P G + P PPPPPP Sbjct: 186 PPKPPPEPPKEPEPPKPCGCSHAFVCVCKPAPPPPPP 222 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 3/75 (4%) Frame = -1 Query: 707 PPPXXXGXGXXX---PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXK 537 PPP G PPPP P PP P P G Sbjct: 8 PPPEPATDGDDAQSHPPPPTPHPATDPPPISPQNPTPPPPPLPASAAAPTTPSPNHSGDP 67 Query: 536 XXYXPPXXPXPPPPP 492 P P PPPPP Sbjct: 68 SRPIPSQAPAPPPPP 82 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 605 GXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 G PPPPPP P PP P P PPPP Sbjct: 218 GAPPPPPPPPPSPHRHPAA----HPPPPPHHPAPRPPPP 252 >08_01_0059 - 394001-394708 Length = 235 Score = 32.7 bits (71), Expect = 0.47 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP PPPP AP PP P P P Sbjct: 5 PPPRRAPPPPATPPPPPRR----APPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHIS 60 Query: 527 XPPXXPXPPPPPP 489 P P PP PPP Sbjct: 61 PPAPVPPPPSPPP 73 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPP P PPP PP P PP P PPPP Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTP----RPYAPPPPSHPLAPPPP 57 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 3/66 (4%) Frame = +2 Query: 683 PXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXX---SPPQKXXXPPPXXXKKKXX 853 P P PPP PP + P PP PPP Sbjct: 5 PPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAP 64 Query: 854 XPPPPS 871 PPPPS Sbjct: 65 VPPPPS 70 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 719 PPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPPS 871 PPP PP P SPP + PP + PPPPS Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIR----PPPPPTPRPYAPPPPS 49 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXKK 474 PPPPPP P P P PPPPPP K+ Sbjct: 313 PPPPPPMPRSRSASPSPSTSSSGSAGP--PAPPPPPPPAAKR 352 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 32.7 bits (71), Expect = 0.47 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPP PPPPPP FP P PPPPP Sbjct: 109 PPPPLSEFPVLREVPSGPDPITSDPPPPPPPLSE---FPVLREVPSGPDPITSDPPPPPP 165 Query: 491 P 489 P Sbjct: 166 P 166 >03_01_0515 - 3864796-3865425 Length = 209 Score = 32.7 bits (71), Expect = 0.47 Identities = 20/73 (27%), Positives = 20/73 (27%), Gaps = 1/73 (1%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPP-PPXXGXGXXFPXGGGXKXX 531 PPP PPP P PPPP PP P Sbjct: 48 PPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPP 107 Query: 530 YXPPXXPXPPPPP 492 P PPPPP Sbjct: 108 PPSPVKSSPPPPP 120 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 593 PPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPP G P PP P PPPPPP Sbjct: 61 PPPPAAGPLMP-PPPPPPSVTSSPPPPPLPPPPPP 94 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/76 (26%), Positives = 21/76 (27%) Frame = -1 Query: 704 PPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYX 525 PP PPP +P PPPPP P Sbjct: 42 PPTEASPPPLAPPPSVTS----SPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAA 97 Query: 524 PPXXPXPPPPPPKXXK 477 P P P PPPP K Sbjct: 98 SPPPPPPSPPPPSPVK 113 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 683 PXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPP 862 P P G PPP P + P SPP PPP K PP Sbjct: 61 PPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPP-PPAASPPPPPPSPPPPSPVKSSPPPP 119 Query: 863 P 865 P Sbjct: 120 P 120 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = -1 Query: 782 PXXXXRPXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXG 603 P P V PP G PPP PPPP P Sbjct: 48 PPPLAPPPSVTSSPPPP--AAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPS 105 Query: 602 XPPPPP 585 PPP P Sbjct: 106 PPPPSP 111 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/61 (26%), Positives = 18/61 (29%) Frame = +2 Query: 797 SPPQKXXXPPPXXXKKKXXXPPPPSXKKXKXPLXXXXXXXXXXXXXKXXXPPPLXXXXPP 976 SPP + PP PPPP+ P PPP PP Sbjct: 41 SPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPP 100 Query: 977 P 979 P Sbjct: 101 P 101 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 557 PXGGGXKXXYXPPXXPXPPPPPP 489 P G PP P PPPPPP Sbjct: 327 PEGSNHNHQGNPPPPPPPPPPPP 349 Score = 28.3 bits (60), Expect(2) = 0.47 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 339 PPPPPPPPPPPP 350 Score = 23.0 bits (47), Expect(2) = 0.47 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 336 GNPPPPPP 343 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 557 PXGGGXKXXYXPPXXPXPPPPPP 489 P G PP P PPPPPP Sbjct: 16 PEGSNHNHQGNPPPPPPPPPPPP 38 Score = 28.3 bits (60), Expect(2) = 0.51 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 29 PPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect(2) = 1.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 30 PPPPPPPPPPPP 41 Score = 23.0 bits (47), Expect(2) = 0.51 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 25 GNPPPPPP 32 Score = 21.0 bits (42), Expect(2) = 1.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 28 PPPPPP 33 >11_01_0364 - 2790450-2790464,2790601-2791116 Length = 176 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = +3 Query: 495 GGGGGGXXGGXIXXFXPPPXGE---XXPPPXLGGGGXG 599 GGGGGG G + + P G PP GGGG G Sbjct: 113 GGGGGGVIDGGMARYHAPGFGTTQWLAPPAWCGGGGGG 150 >03_02_0436 + 8427018-8427707,8429005-8429544 Length = 409 Score = 32.3 bits (70), Expect = 0.62 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -1 Query: 599 PPPPPPXXGX---GXXFPXGGGXKXXYXP---PXXPXPPPPPP 489 PPP P G GGG + + P P P PPPPPP Sbjct: 82 PPPAQPVHGAIHHHHNLGGGGGQQSPFFPLLPPLPPQPPPPPP 124 >01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 Length = 301 Score = 32.3 bits (70), Expect = 0.62 Identities = 30/107 (28%), Positives = 31/107 (28%), Gaps = 11/107 (10%) Frame = +3 Query: 495 GGGGGGXXGGXIXXFXPPPXGEXXPPPXLGG------GGXGXPXPXXXGXXXGXXXXXXX 656 G GGG G P G P P GG GG G P G Sbjct: 77 GHHGGGGSSGTTPSHGGGPSGGALPSPSHGGAAPSHGGGYGASPPVTPSPGGGYGGGSPA 136 Query: 657 XXXGGGXX--PPPPXXGGGXXXSPPH---XXXGXXPPXXPXSXXXXG 782 GGG P GGG +P H G P P S G Sbjct: 137 PSHGGGAYGSSPSTPSGGGSSPTPSHGGGAYGGGGAPATPASHDGHG 183 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PP PP G G PP P PPPPPP Sbjct: 64 PPMPPASAAA-----GDGAAPDQEPPPSPPPPPPPP 94 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PP PP G G PP P PPPPPP Sbjct: 64 PPMPPASAAAGD-----GAAPDQEPPPSPPPPPPPPP 95 >08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287, 1648392-1648573,1648649-1648780,1648900-1649856, 1649949-1650734 Length = 798 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPK 486 P PPP P G P P PPPPPPK Sbjct: 485 PNPPPRPSVSV--PHSGPSNGSAANPPKPPPPPPPPK 519 >07_03_0559 + 19475893-19476783 Length = 296 Score = 31.9 bits (69), Expect = 0.82 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = +3 Query: 492 GGGGGGGXXGGXI--XXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXX 665 GGGGGGG GG F G LGGGG G G G Sbjct: 88 GGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGA 147 Query: 666 GGGXXPPPPXXGG 704 GGG GG Sbjct: 148 GGGVGGGSGTGGG 160 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 31.9 bits (69), Expect = 0.82 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG GG G GGGG G G G GG Sbjct: 105 GGGGGGGGGGG---------YGGYGGYGGYGGGGYGGYNKGYGGGGGGGYSKGFGGGYGG 155 Query: 672 GXXPPPPXXGGG 707 G P GGG Sbjct: 156 GGYPGGGYYGGG 167 >04_04_0057 + 22410167-22411330 Length = 387 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P P P PPPPPP Sbjct: 182 PPPPPPPPAAAAASP-----SPERSPRCQPSPPPPPP 213 >03_02_0085 - 5539188-5539388,5539576-5539714,5540108-5540279, 5541119-5541165,5541450-5541527,5542113-5542177, 5543108-5543155,5543393-5543473,5543586-5543783 Length = 342 Score = 31.9 bits (69), Expect = 0.82 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPPP+ KK Sbjct: 51 PPTPPSPPPPPPEVLKK 67 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXKK 474 PPP P F G Y PP PPPPPP +K Sbjct: 506 PPPFPSAPNTPPGFQGLAGP--FYGPPYPAPPPPPPPPMNRK 545 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/71 (23%), Positives = 17/71 (23%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXY 528 PPP PPPP PP PPP G P Sbjct: 418 PPPPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPPVPPPPPTTGSFMPIPSAPFAGL 477 Query: 527 XPPXXPXPPPP 495 P P P Sbjct: 478 PVPAGPMTAVP 488 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 31.5 bits (68), Expect = 1.1 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 4/76 (5%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXP---PPXGEXXPPPXLGG-GGXGXPXPXXXGXXXGXXXXXXXX 659 GGGGGGG GG + P P G P GG G G G Sbjct: 39 GGGGGGGGGGGYYGPYGPYYGPYYGPYYGPYASGGAAASGGGGGGGGGGGYGYGAGGGYG 98 Query: 660 XXGGGXXPPPPXXGGG 707 GG P GGG Sbjct: 99 QAGGPYYGPYASGGGG 114 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 605 GXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 G P PPP FP Y PP P PPPPPP Sbjct: 22 GQPLLPPPNQPY-YAFPAAA-----YAPPPPPPPPPPPP 54 >01_07_0255 - 42322111-42322308,42322658-42322750,42323127-42323344, 42323476-42323642,42324097-42324207,42324267-42324409, 42324492-42324710,42324975-42325055,42325202-42325381, 42325971-42326301,42326775-42326888,42327036-42327127, 42327631-42328059 Length = 791 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPP P P + + P P PPPPP Sbjct: 7 PPPQPAASLASFLPFSPFRRFLHSPSWRPPPPPPP 41 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXP 611 GGGGGGG GG F P GG G P Sbjct: 152 GGGGGGGCVGGGDAKFLHPERASLFARDEFGGSGGAAAPP 191 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 530 YXPPXXPXPPPPPP 489 + PP P PPPPPP Sbjct: 420 HGPPPPPPPPPPPP 433 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 56 PPPPPPPPPPPPR 68 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 530 YXPPXXPXPPPPPP 489 + PP P PPPPPP Sbjct: 52 HPPPPPPPPPPPPP 65 Score = 28.7 bits (61), Expect(2) = 1.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPPP ++ Sbjct: 55 PPPPPPPPPPPPPRGRR 71 Score = 21.0 bits (42), Expect(2) = 1.4 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 54 PPPPPP 59 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 55 PPPPPP 60 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 30 PPPPPPPPPPPPR 42 Score = 26.2 bits (55), Expect(2) = 6.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPP +K Sbjct: 31 PPPPPPPPPPPRPFSRK 47 Score = 21.0 bits (42), Expect(2) = 1.1 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 29 PPPPPP 34 Score = 21.0 bits (42), Expect(2) = 6.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 30 PPPPPP 35 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 25.4 bits (53), Expect(2) = 1.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 521 PXXPXPPPPPP 489 P P PPPPPP Sbjct: 213 PVTPQPPPPPP 223 Score = 24.2 bits (50), Expect(2) = 1.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 512 PXPPPPPPKXXKK 474 P PPPPPP K Sbjct: 218 PPPPPPPPPPDSK 230 >12_02_1070 - 25814741-25815850 Length = 369 Score = 28.3 bits (60), Expect(2) = 1.4 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 237 PPPPPPPPPPPP 248 Score = 21.4 bits (43), Expect(2) = 1.4 Identities = 9/28 (32%), Positives = 9/28 (32%) Frame = -1 Query: 665 PPXXXXXXXAPXXXXXXXXXGXPPPPPP 582 PP P PPPPPP Sbjct: 217 PPSPSTQQLPPKIRLSPTQAPPPPPPPP 244 >08_01_0420 + 3726392-3727116,3727450-3727648,3727787-3727879, 3728001-3728129,3728445-3728498,3728597-3728674, 3728773-3728835,3729101-3729213,3729392-3729500 Length = 520 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPP 548 GGGGGGG GG F PP Sbjct: 38 GGGGGGGGGGGDAMSFAPP 56 >07_03_0890 - 22332768-22333382 Length = 204 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPP 495 PPPPPP P PP P P PP Sbjct: 84 PPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPP 118 >07_01_0479 + 3606663-3607448 Length = 261 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = -1 Query: 668 PPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXG-XXFPXGGGXKXXYXPPXXPXPPPPP 492 PP P G PP PP G P G PP P PPPP Sbjct: 190 PPGVPPAFPGGPPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPP 249 Query: 491 P 489 P Sbjct: 250 P 250 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 599 PPPPPPXXGXGXX-FPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP FP PP P PPPPPP Sbjct: 51 PPPPPPLDEETLAQFPS---------PPTNPSPPPPPP 79 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 530 YXPPXXPXPPPPPPK 486 Y PP P PPPPPP+ Sbjct: 426 YAPPPPPPPPPPPPQ 440 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.7 bits (61), Expect(2) = 1.4 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 105 PPPPPPPPPPPPQ 117 Score = 21.0 bits (42), Expect(2) = 1.4 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 103 PPPPPP 108 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPPPP P P PPPPP Sbjct: 90 PPPPPPLSPTPTTTSWTTNSSSISASPILPPPPPPP 125 Score = 28.3 bits (60), Expect(2) = 1.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 84 PPPPPPPPPPPP 95 Score = 26.6 bits (56), Expect(2) = 3.8 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 386 PXPPXLXPPPXPPP 427 P PP PPP PPP Sbjct: 80 PSPPPPPPPPPPPP 93 Score = 21.4 bits (43), Expect(2) = 3.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 542 PPPPXGNXPPXLS 580 PPPP PP LS Sbjct: 85 PPPPPPPPPPPLS 97 Score = 21.0 bits (42), Expect(2) = 1.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 82 PPPPPP 87 >01_01_1162 - 9253034-9254229,9254387-9254456,9254473-9254567, 9255344-9255487,9255514-9255622 Length = 537 Score = 25.0 bits (52), Expect(2) = 1.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 P P PPPPPP Sbjct: 201 PTRRPPPPPPPP 212 Score = 24.2 bits (50), Expect(2) = 1.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 206 PPPPPPPPR 214 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 28.3 bits (60), Expect(2) = 1.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 11 PPPPPPPPPPPP 22 Score = 28.3 bits (60), Expect(2) = 1.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P PPPPPP Sbjct: 12 PPPPPPPPPPPP 23 Score = 21.0 bits (42), Expect(2) = 1.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 10 PPPPPP 15 Score = 21.0 bits (42), Expect(2) = 1.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 11 PPPPPP 16 >09_04_0258 - 16175258-16176069,16176111-16176414 Length = 371 Score = 27.5 bits (58), Expect(2) = 1.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -1 Query: 767 RPXXVGGXXPPXXVGGGXXXPPPXXXGXGXXXPPPP 660 +P P GGG PPP G PPPP Sbjct: 204 QPEATSSSARPARAGGGAS-PPPLPVRVGASTPPPP 238 Score = 21.8 bits (44), Expect(2) = 1.9 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -1 Query: 605 GXPPPPPPXXGXGXXFPXGG 546 G PPPP G G GG Sbjct: 231 GASTPPPPHGGAGLPEVGGG 250 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/54 (25%), Positives = 17/54 (31%) Frame = +2 Query: 719 PPPXXXGGXPPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPPSXKK 880 P P PP PPQ+ PPP PPPP ++ Sbjct: 62 PVPVVISEPPPPQPQPEPQPAAPSQPPPPQEQPSPPPPASSNTTQQPPPPQQRQ 115 >11_01_0385 + 2915532-2916482 Length = 316 Score = 30.7 bits (66), Expect = 1.9 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = -1 Query: 722 GGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGG 543 GG P G P PP P PP PP +P GG Sbjct: 164 GGGENPAWPRPGNNQWPPLPPFNQP----PTPEWPHPGNKWPPLPPFHPPPTPAWPHPGG 219 Query: 542 XKXXYXPPXXPXPPPPP 492 K PP PPP P Sbjct: 220 NKWPPLPPFPSHPPPTP 236 >10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081, 7040633-7041213 Length = 426 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPK 486 PPPPP G P P P PPPPPP+ Sbjct: 74 PPPPPSMPGP---LPAPYDHHHRGGGPAQPPPPPPPPQ 108 Score = 29.9 bits (64), Expect = 3.3 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 14/74 (18%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXX-GXPPPPPPXXGX---GXXFPX----------GGGXKX 534 PPPP AP PPPPPP FP G G Sbjct: 75 PPPPSMPGPLPAPYDHHHRGGGPAQPPPPPPPPQPIHAAGEFPPAMLQQHPHYHGWGGNF 134 Query: 533 XYXPPXXPXPPPPP 492 Y PP P P PP Sbjct: 135 SYGPPTQPPAPAPP 148 >06_03_0750 - 24140988-24141037,24141108-24141345,24142158-24142232, 24142345-24142413,24142550-24142581,24143503-24143583, 24143791-24143851,24144135-24144275,24144372-24144563 Length = 312 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYX---PPXXPXPPPPPPKXXKK 474 PPPPP + PP P PPPPPP K Sbjct: 13 PPPPPAFPADPHLVDRAARFSAFASPSPPSPPPPPPPPPSSSSK 56 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPK 486 PPPPPP P K P PPPPPP+ Sbjct: 55 PPPPPPPPQPAKEPPPPTKPKHP-KPKQQQHPPPPPPQ 91 Score = 25.4 bits (53), Expect(2) = 4.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 512 PXPPPPPPKXXKK 474 P PPPPPP+ K+ Sbjct: 55 PPPPPPPPQPAKE 67 Score = 22.6 bits (46), Expect(2) = 4.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 521 PXXPXPPPPP 492 P P PPPPP Sbjct: 53 PHPPPPPPPP 62 >06_01_1181 + 10148653-10149405 Length = 250 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 575 GXGXXFPXGGGXKXXYXPPXXPXPPPPPPK 486 G G GGG P P PPPPPP+ Sbjct: 123 GGGSGGGGGGGRGAAAAPAVVPPPPPPPPE 152 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXX-PXPPPPPP 489 PPPPPP P + P P PPPPPP Sbjct: 120 PPPPPPPPPTTTTKPESLPAEADSEPELKAPPPPPPPP 157 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPP P + P P PPPPPP Sbjct: 124 PPPPPTTTTKPESLPAEADSEPELKAP--PPPPPPPP 158 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPPP K Sbjct: 117 PPPPPPPPPPPPTTTTK 133 >02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960, 1136053-1136116,1136174-1136392,1138562-1138945 Length = 284 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 2/61 (3%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPP--XXGXGXXFPXGGGXKXXYXPPXXPXPPP 498 PPPP AP PP PPP P PP P P P Sbjct: 165 PPPPRTRQVNPAPPPVPSPSAPPLPPQPPPPRNQAQADKAPIPVAPPGAAVPPAQPQPQP 224 Query: 497 P 495 P Sbjct: 225 P 225 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 543 PPPXGEXXPPPXLGGGGXG 599 PPP + PPP GGGG G Sbjct: 11 PPPPPQHPPPPQAGGGGGG 29 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 544 PPPXGKXXPXPXXGGGGGG 600 PPP + P P GGGGGG Sbjct: 11 PPPPPQHPPPPQAGGGGGG 29 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPP 501 PPPPPP GGG + PP P PP Sbjct: 10 PPPPPPQHPPPPQAGGGGGGEFYRGPP--PQPP 40 >01_06_0565 + 30287253-30287502,30287522-30289010,30289133-30289277, 30289679-30289729 Length = 644 Score = 30.7 bits (66), Expect = 1.9 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 P GGG P P PP P P PP P G Sbjct: 218 PTTPGGGGGYTPTPSDA------PPSPSSDTSPTTPGGGGGYTPTPSDTPPSPSSGSSPT 271 Query: 560 FPXGGGXKXXYXPPXXPXPPPP 495 P GGG Y P PP P Sbjct: 272 TPGGGG---GYTPTPSDTPPSP 290 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/82 (25%), Positives = 24/82 (29%) Frame = +1 Query: 544 PPPXGKXXPXPXXGGGGGGXPXXXXXXXXXGAXXXXXXXGGGGXKXPXPXXXGGGXXXPP 723 PP GGGGG P + GGGG P P P Sbjct: 209 PPSPSSDTSPTTPGGGGGYTPTPSDAPPSPSSDTSPTTPGGGGGYTPTP-------SDTP 261 Query: 724 PTXXGGXXPPTXXGRXXFXGXP 789 P+ G P T G + P Sbjct: 262 PSPSSGSSPTTPGGGGGYTPTP 283 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +3 Query: 504 GGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXP 683 GGG PP P GGGG P P GGG P Sbjct: 144 GGGCSSSPTPCDAPPSPSSDTSPTTPGGGGGYSPTPSDTPPSPSSDTSPTTPGGGGGYTP 203 Query: 684 PP 689 P Sbjct: 204 TP 205 Score = 29.1 bits (62), Expect = 5.8 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +3 Query: 501 GGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXX 680 GGG PP P GGG P P GGG Sbjct: 453 GGGNYPPAPTIGNVPPSPSSGTSPSTPGGGCSSSPTP--CDAPPSPSSDTSPTTPGGGYY 510 Query: 681 PPPPXXGGGXXXSPPHXXXGXXPP 752 PP P G S P G PP Sbjct: 511 PPTPSI--GTSPSTPGTGGGYYPP 532 Score = 28.7 bits (61), Expect = 7.7 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +3 Query: 498 GGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGX 677 GGGGG PP P GGGG P P GGG Sbjct: 222 GGGGGYT--PTPSDAPPSPSSDTSPTTPGGGGGYTPTPSDTPPSPSSGSSPTTPGGGGGY 279 Query: 678 XPPP 689 P P Sbjct: 280 TPTP 283 >05_03_0637 - 16465433-16466242 Length = 269 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 11/35 (31%), Positives = 11/35 (31%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPPP PP P P PP Sbjct: 112 PPPPPSSAAAAAASSSSAASSTSAPPLRPLLPRPP 146 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 512 PXPPPPPP 489 P PPPPPP Sbjct: 164 PQPPPPPP 171 >03_02_0865 - 11895257-11895340,11896004-11896069,11896297-11896355, 11896470-11896557,11897158-11897328,11897406-11897564, 11897653-11897835,11897931-11898012,11898753-11898959, 11899099-11899170,11901948-11902055,11902460-11902506 Length = 441 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 P P PPPPPP Sbjct: 196 PSQVPAPPPPPP 207 Score = 23.8 bits (49), Expect(2) = 2.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 202 PPPPPPPPQ 210 >12_01_0442 + 3495333-3496484 Length = 383 Score = 25.0 bits (52), Expect(2) = 2.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 524 PPXXPXPPPPPP 489 PP P P PPPP Sbjct: 213 PPTAPAPAPPPP 224 Score = 23.8 bits (49), Expect(2) = 2.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 219 PAPPPPPPQ 227 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPP AP PPP P PP PPPP Sbjct: 1145 PPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPA 1204 Query: 491 P 489 P Sbjct: 1205 P 1205 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXKK 474 PPPPP P PPPPPP+ K+ Sbjct: 134 PPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPPQPDKR 174 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 557 PXGGGXKXXYXPPXXPXPPPPPP 489 P G PP P PPPPPP Sbjct: 189 PEGSNHNNHGSPPLPPPPPPPPP 211 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPP PP P PP PPP PP Sbjct: 72 PPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPPVPP 108 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P P P PPPPPP Sbjct: 349 PPPPPPPPPP----PPPPPPPKLNTAPKPPPPPPPPP 381 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPPK Sbjct: 354 PPPPPPPPPPPPK 366 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPP 582 P P PPPP P PPPPPP Sbjct: 340 PRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXK 477 PP P PPPPPP K Sbjct: 351 PPPPPPPPPPPPPPPK 366 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPP 582 P P PPPP P PPPPPP Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPPP K Sbjct: 350 PPPPPPPPPPPPPPPPK 366 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXKK 474 P P PP G P G P P P P PPK K Sbjct: 176 PKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGPK 217 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 23.4 bits (48), Expect(3) = 2.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 512 PXPPPPPP 489 P PPPPPP Sbjct: 290 PPPPPPPP 297 Score = 21.8 bits (44), Expect(3) = 2.8 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPP 582 PPPP P PPPPPP Sbjct: 273 PPPPPM------PALSVCGRAAAPPPPPPP 296 Score = 21.4 bits (43), Expect(3) = 2.8 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -1 Query: 506 PPPPPPKXXKK 474 PPPPPP ++ Sbjct: 291 PPPPPPPPARR 301 >05_01_0267 + 2050854-2051682,2051864-2051921,2052518-2052608 Length = 325 Score = 24.6 bits (51), Expect(2) = 3.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 506 PPPPPPKXXKK 474 PPPPPP+ KK Sbjct: 206 PPPPPPQPKKK 216 Score = 23.8 bits (49), Expect(2) = 3.2 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 P P PPPP PK Sbjct: 202 PAAAPPPPPPQPK 214 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPP AP PPPPPP GGG PPP Sbjct: 55 PPPQVIRVFAAAPPPPPAAFFAAVPPPPPPPFEYYPAVGGGGGFGAPVELEAEAEQQPPP 114 >09_03_0145 - 12749288-12751510 Length = 740 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 543 PPPXGEXXPPPXLGGGGXGXPXPXXXG 623 PPP G PPP L G G P P G Sbjct: 34 PPPPGIQPPPPALPGMPHGRPPPPFPG 60 >08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 Length = 145 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -1 Query: 605 GXPPPPPPXXGXGXXFPXGG--GXKXXYXPPXXPXPPP--PPP 489 G P PPP G +P G Y PP P PPP PPP Sbjct: 48 GPYPYPPPS---GAVYPPQGYPSSHGVYPPPQGPYPPPHQPPP 87 >07_03_1713 + 28939446-28939574,28939674-28940231,28940338-28940460, 28940676-28940912 Length = 348 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXX 561 PP G PPP G P P P PP PP G G Sbjct: 128 PPPAYGHQAYPPPPPNREPGHGYHPAPAFYPPQPPPSHDEPGYGYRPPPVGPPGAGYGNR 187 Query: 560 FP 555 P Sbjct: 188 LP 189 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/61 (27%), Positives = 20/61 (32%) Frame = +2 Query: 797 SPPQKXXXPPPXXXKKKXXXPPPPSXKKXKXPLXXXXXXXXXXXXXKXXXPPPLXXXXPP 976 +PP PPP +KK PPP + K L PP PP Sbjct: 126 APPPPPPPPPPTAEEKKLLLFPPPLPPRKKAMLFPLPLPPRKKPLLYPPPLPPKKKPLPP 185 Query: 977 P 979 P Sbjct: 186 P 186 >06_03_1414 + 30012195-30012360,30012448-30012830 Length = 182 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGG 593 GGGGGGG PPP G PP GG G Sbjct: 133 GGGGGGGS---------PPPSGVPLHPPAAGGAG 157 >05_04_0173 + 18724367-18724476,18724570-18724651,18724750-18724840, 18725060-18725172,18725270-18725342,18725445-18725565, 18725665-18725782,18726609-18726748,18726824-18726881, 18727007-18727077,18727181-18727733 Length = 509 Score = 29.9 bits (64), Expect = 3.3 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GG GGGG G P P PPP G G G G GG Sbjct: 426 GGQGGGGSYGNA-----PYPQQGRGPPPPYPGSGMAGTGGPRGGVGGGYGGGSNYPQQGG 480 Query: 672 GXXPPPPXXG 701 P P G Sbjct: 481 PYGPSGPGRG 490 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPK 486 PPPPPP K P P PPP PP+ Sbjct: 36 PPPPPPHHHHHHRRRHRHSKKPKPQPQPQPPPPPLPPQ 73 >04_04_0201 - 23555336-23556008,23556097-23556258,23556353-23557206, 23557452-23557613,23558197-23558649,23559729-23559788, 23559983-23560058,23561546-23561593,23561948-23562022, 23562067-23562494 Length = 996 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPP FP G P PPPPPP Sbjct: 877 PPPPRDPLAPMSNFPYSLGHAPSPALRGLPPPPPPPP 913 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = -1 Query: 593 PPPPXXGXGXXFPXGGGXKXXYXPPXXPXP---PPPPP 489 PPPP G G PP P P PPPPP Sbjct: 186 PPPPADEDGTSASAGAPPPQAPLPPPAPVPAPAPPPPP 223 >01_03_0202 - 13762042-13762572 Length = 176 Score = 25.0 bits (52), Expect(2) = 3.4 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 Query: 492 GGGGGGGXXGG 524 GGGGGGG GG Sbjct: 91 GGGGGGGGGGG 101 Score = 23.4 bits (48), Expect(2) = 3.4 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 FFXXFXGGGGGGG 512 FF GGGGGGG Sbjct: 87 FFGPGGGGGGGGG 99 >01_03_0076 - 12241408-12241545,12241719-12241790,12242173-12242289, 12243307-12245127,12245361-12245810 Length = 865 Score = 24.2 bits (50), Expect(2) = 3.8 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = -1 Query: 569 GXXFPXGGGXKXXYXPPXXPXPPPPPP 489 G F G + P PPPPPP Sbjct: 109 GPHFLNGVATPTSHLPSSAAAPPPPPP 135 Score = 23.8 bits (49), Expect(2) = 3.8 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 131 PPPPPPPPE 139 >12_02_0326 + 17555731-17556387 Length = 218 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 386 PXPPXLXPPPXPPP 427 P PP L PPP PPP Sbjct: 203 PPPPALPPPPPPPP 216 Score = 29.1 bits (62), Expect = 5.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 205 PPALPPPPPPPPR 217 >12_01_1043 + 10731454-10732131 Length = 225 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 Query: 551 GGGXKXXYXPPXXPXPPPPPP 489 GGG PP PPPPPP Sbjct: 35 GGGHAKRVPPPASVPPPPPPP 55 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXG 573 PPPP AP G PPPPPP G Sbjct: 614 PPPPPRPPG--APPPPPPPGKPGGPPPPPPRPG 644 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = -1 Query: 689 GXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXG 573 G G PPPP PPPPPP G Sbjct: 242 GQGFNSPPPPGQGPVPPRDAPPMHHAQGNVPPPPPPNAG 280 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 386 PXPPXLXPPPXPPP 427 P PP L PPP PPP Sbjct: 425 PPPPPLPPPPPPPP 438 >07_03_0820 - 21749477-21749866,21751192-21751590 Length = 262 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 386 PXPPXLXPPPXPPP 427 P PP L PPP PPP Sbjct: 39 PRPPALWPPPPPPP 52 >07_03_0558 + 19461369-19462448 Length = 359 Score = 29.5 bits (63), Expect = 4.4 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG GG F LGGGG G G G GG Sbjct: 102 GGGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGG-GFGGGGGGGLGGGGGHGGGFGAGGG 160 Query: 672 GXXPPPPXXGGG 707 GGG Sbjct: 161 VGGGAGGGVGGG 172 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 386 PXPPXLXPPPXPPP 427 P PP L PPP PPP Sbjct: 98 PPPPELPPPPPPPP 111 >06_01_0486 - 3455030-3455770 Length = 246 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +1 Query: 328 PPPXXFWGXPPXFLGGXXXPXPPXFXPXPXPPPLK 432 PPP PP ++ P PP + P P PP K Sbjct: 125 PPPTP--PSPPPYVPPPTPPSPPPYVPPPSPPATK 157 >05_06_0282 + 26915249-26915881 Length = 210 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 605 GXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 G PP P G GGG PP PPP P Sbjct: 58 GNAPPSPRPHGRVTPLADGGGGGVLRRPPGRGPPPPGP 95 >05_05_0190 - 23110152-23112137 Length = 661 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPP 575 GGGGGGG GG P PPP Sbjct: 58 GGGGGGGLGGGGEHSMPESPTLPLPPPP 85 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPPPP P PP P PPPPP Sbjct: 72 PPPPPPAPRP----PRRHHRIPPPPPPLLPTPPPPP 103 Score = 29.1 bits (62), Expect = 5.8 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 3/77 (3%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXX- 531 PPP P PP P PPPPPP P Sbjct: 58 PPPPLPTPTVTTPTPPPPPPAPRPPRRHHRI-----PPPPPPLLPTPPPPPASISPTPAP 112 Query: 530 -YXPPXXPXPPP-PPPK 486 PP P PPP P PK Sbjct: 113 PLPPPPAPAPPPTPTPK 129 >04_03_0801 - 19828175-19828770,19828913-19828994 Length = 225 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 498 GGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGG 593 GGGGG P P PPP GGGG Sbjct: 181 GGGGGGCKKPCCSPPPCPWQPVCPPPPCGGGG 212 >02_04_0563 - 23895573-23895614,23896330-23896390,23896901-23897025, 23897217-23897302,23898052-23898167,23898274-23898336, 23898451-23898530,23898751-23898871,23899419-23899501, 23900081-23900155,23900436-23900936 Length = 450 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGG 590 GGGGGGG G F P P GGG Sbjct: 47 GGGGGGGGGGARPTRFGLARQSSLDPTPREGGG 79 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 4.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXK 477 PPPPPP PP P PPPPPP K Sbjct: 353 PPPPPPPPPPPPP-----------PPPPPPRPPPPPPPIKK 382 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 800 PPQKXXXPPPXXXKKKXXXPPPPSXKKXKXP 892 PP PPP PPPP KK P Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 >02_01_0158 - 1103461-1104186 Length = 241 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXG 599 GGGGGGG GG + G GGGG G Sbjct: 179 GGGGGGGGGGGGGACYNCGETGHLARDCYNGGGGGG 214 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 24.2 bits (50), Expect(2) = 5.0 Identities = 12/42 (28%), Positives = 12/42 (28%) Frame = -1 Query: 707 PPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPP 582 PPP P PP P P PPPP Sbjct: 78 PPPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRPPPP 119 Score = 23.4 bits (48), Expect(2) = 5.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 512 PXPPPPPP 489 P PPPPPP Sbjct: 154 PLPPPPPP 161 >01_01_0796 + 6190931-6192745 Length = 604 Score = 27.1 bits (57), Expect(2) = 5.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 332 PPLXFGGXXXXFWGDXXXPXPPXLXPPPXP 421 PPL G G P PP PPP P Sbjct: 176 PPLRRRGGKRPIQGSSVPPPPPPPPPPPQP 205 Score = 20.6 bits (41), Expect(2) = 5.1 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 Query: 407 PPPXPPP 427 PPP PPP Sbjct: 237 PPPPPPP 243 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 26.6 bits (56), Expect(2) = 5.2 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXK 477 PP PPPPPP+ K Sbjct: 55 PPMVAAPPPPPPQYAK 70 Score = 21.0 bits (42), Expect(2) = 5.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 51 PPPPPP 56 >05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 Length = 368 Score = 26.6 bits (56), Expect(2) = 5.3 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 495 GGGGGGXXGGXIXXFXPPPXG-EXXPPPXLGGGGXG 599 G G GG G F P G + PP G GG G Sbjct: 177 GDGQGGGAGAVAPPFAMTPHGKQPVAPPGNGNGGGG 212 Score = 21.0 bits (42), Expect(2) = 5.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 492 GGGGGGG 512 GGGGGGG Sbjct: 134 GGGGGGG 140 >09_06_0148 - 21214460-21214561,21214993-21215339,21215428-21215538, 21215673-21215835,21215921-21215999,21216110-21216228 Length = 306 Score = 26.6 bits (56), Expect(2) = 5.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPP + ++ Sbjct: 200 PPAAPPPPPPPARGRRR 216 Score = 21.0 bits (42), Expect(2) = 5.4 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 196 PPPPPP 201 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 24.6 bits (51), Expect(2) = 5.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 46 PP--PPPPPPPPR 56 Score = 23.0 bits (47), Expect(2) = 5.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 45 GPPPPPPP 52 >05_07_0284 - 28943527-28943625,28944417-28944785 Length = 155 Score = 24.6 bits (51), Expect(2) = 5.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 605 GXPPPPPPXXG 573 G PPPPPP G Sbjct: 28 GTPPPPPPSTG 38 Score = 23.0 bits (47), Expect(2) = 5.8 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -1 Query: 506 PPPPPPKXXKK 474 PPPPPP +K Sbjct: 30 PPPPPPSTGRK 40 >12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203, 2195479-2195505,2195794-2196024,2196523-2196692, 2197278-2197421,2198036-2198083,2198503-2198566 Length = 749 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 492 GGGGGGGXXGGXI---XXFXPPPXGEXXPPPXLGGGGXGXP 605 GGGGGGG GG + P P + GGG G P Sbjct: 329 GGGGGGGGQGGGVGGPMGGMPAQQQAMMMRPNMMGGGAGFP 369 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 498 GGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXG 623 GG G G + PPP PPP GGG G P G Sbjct: 250 GGCGRVYGYSVPSARPPPL---LPPPCYSGGGGGGYTPYCGG 288 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 671 PPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXG 573 PPPP AP G PPPPPP G Sbjct: 920 PPPPRPPG---APPPPPPPGKPGGPPPPPPPPG 949 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPP P P G P P PPPPPP Sbjct: 920 PPPPRPPGAPPPPPPPG--------KPGGPPPPPPPP 948 >09_04_0112 - 14757947-14758972 Length = 341 Score = 29.1 bits (62), Expect = 5.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 530 YXPPXXPXPPPPPP 489 + PP P PPPPPP Sbjct: 289 FNPPTSPPPPPPPP 302 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 746 PPXXXXVXXXXGGXPXXSPPQKXXXPPPXXXKKKXXXPPPP 868 PP GG +PPQ PPP +++ PPPP Sbjct: 4 PPPPPQAGVAGGGG---APPQWGAIPPPVPHQQQQYAPPPP 41 >06_03_0790 - 24636805-24637770 Length = 321 Score = 29.1 bits (62), Expect = 5.8 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXGXXXGXXXXXXXXXXGG 671 GGGGGGG GG G GGGG G G G GG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Query: 672 G 674 G Sbjct: 142 G 142 >06_02_0257 - 13533689-13533714,13533799-13533925,13534013-13534121, 13534193-13534272,13534758-13534979,13536070-13536318, 13537032-13537484,13539834-13540556 Length = 662 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 495 GGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXP 605 GGGGG GG P PPP G G P Sbjct: 45 GGGGGDRRGGFQLPPDAAPPPPPPPPPSSAAAGGGGP 81 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXKK 474 PPPPPP P G K PP P PPPPP KK Sbjct: 1931 PPPPPPPP------PVEGKPK----PP--PHAPPPPPPEAKK 1960 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 539 KXXYXPPXXPXPPPPPP 489 K PP P PPPPPP Sbjct: 1922 KPKQPPPHAPPPPPPPP 1938 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 8/49 (16%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXP--------PXXPXPPPPPPKXXK 477 PPPPPP G G P P P PPP PP K Sbjct: 69 PPPPPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPPPPSPPNGGK 117 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXP-PXXPXPPPPPP 489 PPPPPP G G P P PPPPP Sbjct: 173 PPPPPPSPPNGANVIGDGKRLTPIGPDPIHNEFPPPPP 210 >03_05_0688 + 26762668-26762893,26763027-26763101,26763865-26764032, 26764983-26765114,26765538-26765677,26765840-26765908, 26766325-26766435,26766854-26766973,26768223-26768324, 26769608-26769778,26769865-26769944,26770119-26770182 Length = 485 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGG 593 GGGGGGG GG P G P +G G Sbjct: 14 GGGGGGGGGGGGGGGVDPAGGGSGGGGPGMGRRG 47 >03_05_0234 - 22200754-22201476 Length = 240 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +3 Query: 492 GGGGGGGXXG---GXIXXFXPPPXGEXXPPPXLGGGGXG 599 GG GGGG G G PP PPP GGGG G Sbjct: 102 GGRGGGGCDGRGCGARQRASSPP-----PPPAAGGGGFG 135 >03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828, 9971146-9971935,9972002-9972051,9972618-9972704 Length = 571 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 800 PPQKXXX--PPPXXXKKKXXXPPPPSXKKXK 886 PPQK PPP K PPPP K K Sbjct: 82 PPQKPDKVSPPPAQKPSKVSPPPPPPQKSAK 112 >01_05_0552 - 23173106-23173184,23173266-23173411,23173543-23174022, 23174106-23174161,23175538-23175637,23175708-23175765, 23176163-23176278,23176915-23176974,23177297-23177383, 23178250-23178341,23178409-23178587,23178946-23179087, 23179655-23179706,23180241-23180473,23180569-23180745, 23180882-23181044,23181242-23181392,23181493-23181574, 23182193-23182332,23182499-23183013 Length = 1035 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGGG 590 GGGGGGG GG PP G GG Sbjct: 106 GGGGGGGGGGGGGGGSQQPPYGSQPSGSQHSGG 138 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 5/67 (7%) Frame = -1 Query: 671 PPPPXXXXXXXA-----PXXXXXXXXXGXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPX 507 PPPP A P PPPPPP G GG P Sbjct: 161 PPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPPAGGNFTAPSPAGGMNFTAPAPGTNG 220 Query: 506 PPPPPPK 486 PPP+ Sbjct: 221 TAAPPPR 227 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 24.2 bits (50), Expect(2) = 5.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 521 PXXPXPPPPPPK 486 P P PPPP PK Sbjct: 123 PPPPPPPPPSPK 134 Score = 23.0 bits (47), Expect(2) = 5.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 122 GPPPPPPP 129 >03_02_0178 + 6195402-6199158,6199438-6200003 Length = 1440 Score = 24.2 bits (50), Expect(2) = 6.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 23 PPPPPPPPR 31 Score = 23.0 bits (47), Expect(2) = 6.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 22 GPPPPPPP 29 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 23.0 bits (47), Expect(3) = 6.2 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 506 PPPPPPK 486 PPPPPPK Sbjct: 44 PPPPPPK 50 Score = 21.4 bits (43), Expect(3) = 6.2 Identities = 9/27 (33%), Positives = 9/27 (33%) Frame = -1 Query: 740 PPXXVGGGXXXPPPXXXGXGXXXPPPP 660 PP PP G PPPP Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPP 47 Score = 21.0 bits (42), Expect(3) = 6.2 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 43 PPPPPP 48 >10_01_0086 - 1064650-1065379,1065796-1065950,1066029-1066141, 1066238-1066345,1066773-1066890,1066996-1067069, 1067595-1067690,1068062-1068455 Length = 595 Score = 24.2 bits (50), Expect(2) = 6.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 106 PPPPPPPPR 114 Score = 23.0 bits (47), Expect(2) = 6.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 105 GPPPPPPP 112 >03_05_1016 + 29726949-29727503,29728863-29729504 Length = 398 Score = 24.2 bits (50), Expect(2) = 6.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 512 PXPPPPPPKXXKK 474 P PPPPPP+ ++ Sbjct: 80 PPPPPPPPEGLER 92 Score = 23.0 bits (47), Expect(2) = 6.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 Query: 605 GXPPPPPP 582 G PPPPPP Sbjct: 78 GAPPPPPP 85 >02_05_0714 - 31164078-31164554 Length = 158 Score = 25.4 bits (53), Expect(2) = 7.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 474 FFXXFXGGGGGGGXXGG 524 F F GGGGGG GG Sbjct: 65 FIRRFGRGGGGGGGGGG 81 Score = 21.8 bits (44), Expect(2) = 7.5 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 582 GGGGXGXPXPXXXG 623 GGGG G P P G Sbjct: 75 GGGGGGGPRPHNYG 88 >12_02_0640 - 21447470-21448309 Length = 279 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 800 PPQKXXXPPPXXXKKKXXXPPPPSXKKXKXP 892 PP++ P P + + PPP S KK P Sbjct: 213 PPERRESPSPPRGRPRTPPPPPGSPKKPATP 243 >12_02_0635 - 21430245-21431156 Length = 303 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 800 PPQKXXXPPPXXXKKKXXXPPPPSXKKXKXP 892 PP++ P P + + PPP S KK P Sbjct: 210 PPERRESPSPPRGRPRTPPPPPGSPKKPATP 240 >11_06_0561 - 24984960-24985205,24985283-24985354,24985906-24985977, 24986612-24986782,24987464-24987653,24987733-24987976, 24988162-24988474,24988687-24989517,24989628-24989672, 24989677-24989790,24989877-24990371,24990627-24990824, 24990902-24991357 Length = 1148 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 498 GGGGGXXGGXIXXFXPPPXGEXXPPPXLGGGGXGXPXPXXXG 623 G GGG GG P P PP GG G G P G Sbjct: 46 GAGGGADGGS-----PAPRAASPPPTAAGGQGGGGGGPVSGG 82 >11_06_0046 - 19585032-19585109,19585198-19585278,19585460-19585501, 19586058-19586149,19586243-19586312,19587140-19587223, 19587696-19587770,19587878-19587949,19588082-19588331, 19590224-19590291,19590380-19590460,19590642-19590683, 19591240-19591331,19591425-19591494,19592322-19592405, 19592878-19592952,19593060-19593131,19593264-19593305 Length = 489 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 256 PPLLPSPPPPPPQ 268 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P G PP P PP PP Sbjct: 33 PPPPPPLEPAPPSTPQLRGEA---SPPPPPPPPVGPP 66 >10_04_0005 + 7390697-7390705,7390943-7391096,7391225-7391424, 7391649-7391739,7392042-7392385 Length = 265 Score = 28.7 bits (61), Expect = 7.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 821 PPPXXXKKKXXXPPPPSXKKXKXP 892 PPP KK+ PPP KK + P Sbjct: 100 PPPEEEKKEEAPAPPPEEKKEEPP 123 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPPP ++ Sbjct: 14 PPPPPPPPPPPPPPLRR 30 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = -1 Query: 605 GXPPPPPPXXG----XGXXFPXGGGXKXXYXPPXXPXPPPPPPK 486 G PPPPPP P + PP PPPPP+ Sbjct: 42 GFPPPPPPGSTFVPLPQSGVPPPPPLGSFFVPPPQSRVPPPPPQ 85 >07_03_1751 - 29215074-29216270 Length = 398 Score = 28.7 bits (61), Expect = 7.7 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +3 Query: 486 FXGGGGGG-GXXGGXIXXFXPPPXGEXXPPPXLGGG-GXGXPXPXXXGXXXGXXXXXXXX 659 F GG GGG G GG F G +GGG G G G G Sbjct: 69 FGGGAGGGLGHGGGIGGGFGGGKGGGLGGGVGVGGGIGHGGGVGGGFGGGKGGGLGGGGG 128 Query: 660 XXGGGXXPPPPXXGGG 707 GGG GGG Sbjct: 129 LGGGGGGGAGGGLGGG 144 >07_03_0154 + 14509979-14512033 Length = 684 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 55 PPPPPPPPPPPPQ 67 >06_03_1310 + 29238644-29240260 Length = 538 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 665 GGGXKXPXPXXRGGXKXXPPPXXXGGXPPXXXXVXXXXGGXPXXSPP 805 GGG K P P G PPP G P P S P Sbjct: 490 GGGGKLPFPPVHGVAYSSPPPPPSGDKLPFPPVYGVAYSSPPPPSKP 536 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 28.7 bits (61), Expect = 7.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 599 PPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPPP P G Y P PPPPP Sbjct: 20 PPPPPP--------PPGTSLYASYRHHAYPPHPPPPP 48 >05_07_0294 - 29038259-29038420,29038526-29038632,29038889-29039093, 29039173-29039536,29039588-29039772,29039879-29040080, 29040697-29041589 Length = 705 Score = 28.7 bits (61), Expect = 7.7 Identities = 21/72 (29%), Positives = 22/72 (30%), Gaps = 7/72 (9%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXP----PPXGEXXPPPXLGGGGXGXP---XPXXXGXXXGXXXXX 650 G GGGGG GG P P G P + P P G G Sbjct: 121 GSGGGGGGCGGGSTASSPLTNALPTGNICPSGRVASAAPAPPRRARPDVLGSGTGHYGHG 180 Query: 651 XXXXXGGGXXPP 686 GGG PP Sbjct: 181 SIMRGGGGMTPP 192 >04_01_0354 - 4646826-4647314 Length = 162 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 93 PPPPPPPPPPPPQ 105 >04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626, 1848780-1848887,1849001-1849204,1849294-1849525, 1849602-1849751,1849830-1850007,1850416-1850519, 1850611-1850933,1851274-1851459,1851672-1851899 Length = 1020 Score = 28.7 bits (61), Expect = 7.7 Identities = 23/87 (26%), Positives = 23/87 (26%) Frame = -1 Query: 749 GXXPPXXVGGGXXXPPPXXXGXGXXXPPPPXXXXXXXAPXXXXXXXXXGXPPPPPPXXGX 570 G PP G PPP G PPP P P PPP Sbjct: 125 GTAPPPSQGPFGTAPPPSQGPFG-TAPPPSQGPFAASVPPSQGPFASAQPPFRPPPSLVQ 183 Query: 569 GXXFPXGGGXKXXYXPPXXPXPPPPPP 489 G Y P P PPP Sbjct: 184 SPT-ASGMAPPSAYVRPPPPVQSQPPP 209 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 530 YXPPXXPXPPPPPP 489 + PP P PPPPPP Sbjct: 353 WVPPPPPPPPPPPP 366 >02_03_0279 + 17250347-17252098 Length = 583 Score = 28.7 bits (61), Expect = 7.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 524 PPXXPXPPPPPPKXXKK 474 PP P PPPPPP K Sbjct: 124 PPPPPPPPPPPPPLFAK 140 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPP 489 PPPPP P + PP P PPPP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPP 154 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.7 bits (61), Expect = 7.7 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPPPPP+ Sbjct: 44 PPGVPPPPPPPPQ 56 >01_05_0433 - 22094784-22095659 Length = 291 Score = 28.7 bits (61), Expect = 7.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 492 GGGGGGGXXGGXIXXFXPPPXGEXXPPP 575 GGGG GG GG P G PPP Sbjct: 28 GGGGVGGGGGGGAARPPPMVPGRVPPPP 55 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 28.7 bits (61), Expect = 7.7 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 605 GXPPPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPPPKXXKK 474 G PPPPPP GG Y PPPPP KK Sbjct: 124 GHPPPPPPPPPPFKGDHYGG----VYQNWQQNGPPPPPDHVLKK 163 >01_01_0762 + 5889925-5890136,5891110-5891273,5891755-5891878, 5891941-5892073,5892629-5892732,5892867-5895780, 5895876-5895965,5896251-5896355,5896633-5896740, 5896826-5896876 Length = 1334 Score = 28.7 bits (61), Expect = 7.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 486 FXGGGGGGGXXGGXIXXFXPPPXGEXXPPPXLGG 587 + GGGGGGG GG GE P L G Sbjct: 20 YGGGGGGGGGGGGGGVGAAAKKGGEAEPKALLEG 53 >01_01_0553 - 4067921-4068180,4068437-4068455,4069101-4070225 Length = 467 Score = 28.7 bits (61), Expect = 7.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 596 PPPPPXXGXGXXFPXGGGXKXXYXPPXXPXPPPPP 492 PPPPP P G P P PPPPP Sbjct: 36 PPPPPS-------PRANGTAAAAKPSASPPPPPPP 63 >05_03_0001 - 7269231-7269436,7269536-7270100,7270600-7270821, 7270913-7271155,7271227-7271481,7272017-7272370, 7273082-7273164,7273250-7273630,7273874-7274027 Length = 820 Score = 24.2 bits (50), Expect(2) = 8.3 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 4 PPPPPPPPR 12 Score = 22.6 bits (46), Expect(2) = 8.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 521 PXXPXPPPPP 492 P P PPPPP Sbjct: 2 PAPPPPPPPP 11 >05_04_0347 + 20479682-20479753,20480136-20480813,20481143-20482195, 20482345-20482406,20482491-20482541,20482635-20482719, 20483253-20483342,20483472-20483563,20483704-20483728 Length = 735 Score = 24.2 bits (50), Expect(2) = 8.3 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 698 PPPPPPPPR 706 Score = 22.6 bits (46), Expect(2) = 8.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 521 PXXPXPPPPP 492 P P PPPPP Sbjct: 696 PNPPPPPPPP 705 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 25.8 bits (54), Expect(2) = 8.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 524 PPXXPXPPPPPPK 486 PP P PPP PP+ Sbjct: 5 PPPPPPPPPSPPR 17 Score = 21.0 bits (42), Expect(2) = 8.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -1 Query: 599 PPPPPP 582 PPPPPP Sbjct: 4 PPPPPP 9 >12_01_0841 - 7873458-7874225 Length = 255 Score = 25.0 bits (52), Expect(2) = 9.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 Query: 492 GGGGGGGXXGG 524 GGGGGGG GG Sbjct: 147 GGGGGGGGQGG 157 Score = 21.8 bits (44), Expect(2) = 9.2 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 582 GGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGGG 707 GGGG G G G GGG GGG Sbjct: 151 GGGGQGGGNGSGYGSGYGSGYGQGGGASGGGYGQGGGGGGGG 192 >10_08_0213 - 15912048-15912716 Length = 222 Score = 25.0 bits (52), Expect(2) = 9.3 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 Query: 492 GGGGGGGXXGG 524 GGGGGGG GG Sbjct: 153 GGGGGGGQGGG 163 Score = 21.8 bits (44), Expect(2) = 9.3 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 582 GGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGGG 707 GGGG G G G GGG GGG Sbjct: 156 GGGGQGGGYGSGSGYGSGRGYGQGGGAYGGGYASGGGGGGGG 197 >02_01_0143 + 1030081-1030587,1032106-1032114 Length = 171 Score = 24.2 bits (50), Expect(2) = 9.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 512 PXPPPPPPK 486 P PPPPPP+ Sbjct: 58 PPPPPPPPR 66 Score = 22.6 bits (46), Expect(2) = 9.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 Query: 521 PXXPXPPPPP 492 P P PPPPP Sbjct: 56 PSPPPPPPPP 65 >12_01_0838 - 7830944-7831444 Length = 166 Score = 25.0 bits (52), Expect(2) = 9.6 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 Query: 492 GGGGGGGXXGG 524 GGGGGGG GG Sbjct: 37 GGGGGGGGGGG 47 Score = 21.8 bits (44), Expect(2) = 9.6 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 582 GGGGXGXPXPXXXGXXXGXXXXXXXXXXGGGXXPPPPXXGGG 707 GGGG G G G GGG GGG Sbjct: 41 GGGGGGGGNGSGSGSGYGYNYGKGGGQSGGGQGSGGGGGGGG 82 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,893,766 Number of Sequences: 37544 Number of extensions: 1128794 Number of successful extensions: 25309 Number of sequences better than 10.0: 179 Number of HSP's better than 10.0 without gapping: 3809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16623 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2928685000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -