BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A22 (897 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory pro... 24 1.9 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 23 2.5 >DQ855491-1|ABH88178.1| 144|Tribolium castaneum chemosensory protein 5 protein. Length = 144 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 193 FGVTFILIADLVNG 152 FGV FI+ +D VNG Sbjct: 9 FGVFFIIFSDFVNG 22 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 23.4 bits (48), Expect = 2.5 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 469 VITLRAFYGQCHSEVLVLVTPWTDAAPSRPNCLKSQM 579 + L FYG C+ VL+L+ A R + QM Sbjct: 166 LFALHEFYGFCYLWVLILICNIALAFKQRYQLINEQM 202 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,857 Number of Sequences: 336 Number of extensions: 2006 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -