BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A21 (883 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 pro... 89 2e-17 U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. 89 2e-17 U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 pro... 89 2e-17 BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 p... 89 2e-17 BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 p... 89 2e-17 BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 p... 89 2e-17 BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 p... 89 2e-17 BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 p... 89 2e-17 AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA seq... 89 2e-17 >Z49148-1|CAA89008.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >U49083-1|AAC50647.1| 159|Homo sapiens HIP protein. Length = 159 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >U10248-1|AAC50499.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC071909-1|AAH71909.1| 161|Homo sapiens ribosomal protein L29 protein. Length = 161 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC071663-1|AAH71663.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC070481-1|AAH70481.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC070190-1|AAH70190.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >BC008926-1|AAH08926.1| 159|Homo sapiens ribosomal protein L29 protein. Length = 159 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 57 >AL450405-1|CAI16223.1| 172|Homo sapiens protein ( Human DNA sequence from clone RP11-632C17 on chromosome 6 Contains the gene for a novel protein similar to ribosomal protein L29 ). Length = 172 Score = 89.0 bits (211), Expect = 2e-17 Identities = 40/57 (70%), Positives = 45/57 (78%) Frame = +3 Query: 90 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNLKPAKQL 260 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N K K++ Sbjct: 16 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKM 72 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,131,003 Number of Sequences: 237096 Number of extensions: 1135136 Number of successful extensions: 2121 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2121 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11270645666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -