BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A17 (942 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyce... 26 6.7 SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein Sap49|Schizo... 26 8.8 >SPAC22A12.09c |sap114||splicing factor Sap114|Schizosaccharomyces pombe|chr 1|||Manual Length = 481 Score = 26.2 bits (55), Expect = 6.7 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 732 PGXSPWKPPRALSCSXPCRSXSGIPVPPFLPFXESGGXLS 851 P PW+P S P + G+ +PP L E GG S Sbjct: 313 PTAEPWEP-----ISAPKKQEFGVSLPPSLASPEKGGISS 347 >SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein Sap49|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 25.8 bits (54), Expect = 8.8 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = +3 Query: 801 IPVPPFLPFXESGGXLSPXXXPLLGXXQXPGVXXVSPPKPWGLV 932 + +P LPF + P++ PG + PP P G+V Sbjct: 254 LSIPNVLPFTAAQHFPGMPAMPMMNVPMGPGGAPLVPPPPPGMV 297 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,397,417 Number of Sequences: 5004 Number of extensions: 33937 Number of successful extensions: 53 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 479324640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -