BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A17 (942 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001591-1|AAN71346.1| 760|Drosophila melanogaster RE27138p pro... 30 4.0 AY071846-1|AAL60055.1| 760|Drosophila melanogaster hepatocyte g... 30 4.0 AY051789-1|AAK93213.1| 760|Drosophila melanogaster LD30575p pro... 30 4.0 AE014134-454|AAF51222.1| 647|Drosophila melanogaster CG2903-PA,... 30 4.0 AE014134-453|AAN10412.2| 760|Drosophila melanogaster CG2903-PC,... 30 4.0 AE014134-452|AAF51221.2| 760|Drosophila melanogaster CG2903-PB,... 30 4.0 >BT001591-1|AAN71346.1| 760|Drosophila melanogaster RE27138p protein. Length = 760 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 661 PXRASQXSTLXSKVAETPTGXLRYQAFPPG--NPLVRSPVP 777 P A L A P G ++QA PPG NP ++ P+P Sbjct: 557 PYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMP 597 >AY071846-1|AAL60055.1| 760|Drosophila melanogaster hepatocyte growth factor-regulatedtyrosine kinase substrate protein. Length = 760 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 661 PXRASQXSTLXSKVAETPTGXLRYQAFPPG--NPLVRSPVP 777 P A L A P G ++QA PPG NP ++ P+P Sbjct: 557 PYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMP 597 >AY051789-1|AAK93213.1| 760|Drosophila melanogaster LD30575p protein. Length = 760 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 661 PXRASQXSTLXSKVAETPTGXLRYQAFPPG--NPLVRSPVP 777 P A L A P G ++QA PPG NP ++ P+P Sbjct: 557 PYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMP 597 >AE014134-454|AAF51222.1| 647|Drosophila melanogaster CG2903-PA, isoform A protein. Length = 647 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 661 PXRASQXSTLXSKVAETPTGXLRYQAFPPG--NPLVRSPVP 777 P A L A P G ++QA PPG NP ++ P+P Sbjct: 444 PYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMP 484 >AE014134-453|AAN10412.2| 760|Drosophila melanogaster CG2903-PC, isoform C protein. Length = 760 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 661 PXRASQXSTLXSKVAETPTGXLRYQAFPPG--NPLVRSPVP 777 P A L A P G ++QA PPG NP ++ P+P Sbjct: 557 PYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMP 597 >AE014134-452|AAF51221.2| 760|Drosophila melanogaster CG2903-PB, isoform B protein. Length = 760 Score = 30.3 bits (65), Expect = 4.0 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 661 PXRASQXSTLXSKVAETPTGXLRYQAFPPG--NPLVRSPVP 777 P A L A P G ++QA PPG NP ++ P+P Sbjct: 557 PYAAGVPGYLPQGPAPAPNGHGQFQAIPPGMYNPAIQQPMP 597 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,345,623 Number of Sequences: 53049 Number of extensions: 468005 Number of successful extensions: 823 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4669258284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -