BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A15 (860 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0670 - 30764007-30764135,30764404-30764548,30765200-307653... 31 1.6 >02_05_0670 - 30764007-30764135,30764404-30764548,30765200-30765309, 30765578-30765761,30765857-30765969,30766242-30766412, 30766493-30766756,30767537-30767782 Length = 453 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +3 Query: 345 RILFASVTHRLNVCAAHTSVMTIVEERLSKF-VNSSCVLSVPESYMTLLAIHSCDLL 512 RIL S+ N A H + + E + +N SC +PE M CDLL Sbjct: 143 RILIGSIMEEYNKAAWHELIERVEESGVDALEINFSCPHGMPERKMGAAVGQDCDLL 199 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,057,962 Number of Sequences: 37544 Number of extensions: 329211 Number of successful extensions: 658 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -