BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A10 (972 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 1.2 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 6.3 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 24.6 bits (51), Expect = 1.2 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 2/39 (5%) Frame = +3 Query: 684 PPPXXPSXGXRGGXPXXXXXXXPXG--XPPSXPPPXXPP 794 P PS G R G P P G P P P PP Sbjct: 47 PGSCDPSVGLRQGIPPHHYGGPPSGGQPPQGMPYPRFPP 85 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.2 bits (45), Expect = 6.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -2 Query: 344 PSFYTRAGGGAEAXPPHRRGXXGXHPLRS 258 PS + GGG P G HPL S Sbjct: 81 PSLSSGLGGGLSGMPMPALGFGLGHPLES 109 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,961 Number of Sequences: 336 Number of extensions: 2618 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27513178 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -