BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A08 (884 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X98185-1|CAA66860.1| 123|Anopheles gambiae histone H2B protein. 94 6e-21 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 29 0.14 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 26 1.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 7.1 >X98185-1|CAA66860.1| 123|Anopheles gambiae histone H2B protein. Length = 123 Score = 93.9 bits (223), Expect = 6e-21 Identities = 48/84 (57%), Positives = 66/84 (78%) Frame = +1 Query: 199 IYLYKLLRAVTQDNLGISRKSMLIMNNFVNDMLEKIAVEAGRLVAHGKKNTLGSREIQSA 378 IY+YK+L+ V D GIS K+M IMN+FVND+ E+IA ++ RL + K++T+ SREIQ+A Sbjct: 38 IYIYKVLKQVHPDT-GISSKAMSIMNSFVNDIFERIARKS-RLAHYNKRSTITSREIQTA 95 Query: 379 VKLLVPGELATHANSEGMKAISMY 450 V+LL+PGELA HA SEG KA++ Y Sbjct: 96 VRLLLPGELAKHAVSEGTKAVTKY 119 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 29.5 bits (63), Expect = 0.14 Identities = 15/60 (25%), Positives = 31/60 (51%) Frame = +3 Query: 306 RRGSRKAGRPRQEEYSGQQRNPICRQVTSTGRAGHTRQLRGHEGHKHVPFEQKERLQKQR 485 R + G+PR ++ QQ+ P +Q R +Q H+G ++VP + +++ +Q+ Sbjct: 245 RYRGKATGKPRSQQQPQQQQQPQQKQQQLQRRQQQQQQ---HQGQRYVPPQLRQQAHQQQ 301 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 25.8 bits (54), Expect = 1.8 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +3 Query: 327 GRPRQEEYSGQQRNPICRQVTSTGRAGHTRQLRGHEGHKHVPFEQKERLQKQR 485 G P Q YS Q NP+ ++ + T + G GH+ +LQ Q+ Sbjct: 58 GTPHQAHYSPQSYNPLAGAGATSVNSASTGAVGG--GHQSTDMVDYTQLQPQK 108 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 7.1 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = -1 Query: 347 FFLPWATSLPASTAIFSSISLTKLFMINIDFLEMP--RLSC 231 F P+ + P + A + ISL +L ++ LE+P RL C Sbjct: 68 FSFPFFSFAPCTLASATEISLPELVTRSLSNLELPSCRLPC 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 592,402 Number of Sequences: 2352 Number of extensions: 9864 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -