BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A08 (884 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 1.2 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 6.5 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.6 bits (51), Expect = 1.2 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = -1 Query: 365 SLLPRVFFLPWATS----LPASTAIFSSISLTKLFM 270 S++PR+ +L W +S ST + + IS K FM Sbjct: 803 SVIPRILYLTWYSSNGDIKVPSTKVLAMISSVKSFM 838 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 Query: 296 WRRSPWKPEGWSPTARRILWA 358 WR PW P W +L+A Sbjct: 553 WRFQPWGPFTWGGIGVVVLFA 573 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,758 Number of Sequences: 438 Number of extensions: 2734 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28766349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -