BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A07 (836 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF338650-1|AAK07661.1| 2641|Homo sapiens PDZ domain-containing p... 30 9.0 AB002298-1|BAA20760.2| 2847|Homo sapiens KIAA0300 protein. 30 9.0 >AF338650-1|AAK07661.1| 2641|Homo sapiens PDZ domain-containing protein AIPC protein. Length = 2641 Score = 30.3 bits (65), Expect = 9.0 Identities = 24/71 (33%), Positives = 31/71 (43%), Gaps = 4/71 (5%) Frame = +2 Query: 41 SVKTXDSGSAAGLCQGYPACNAXAPTCGWGRVGPGCDGRDGVQRRRSASGLAA----XTD 208 S +T DSGS G QG+P A + PG G+ RR A+G A + Sbjct: 1245 SSQTGDSGSQEGSAQGHPPAGAGGGSSCRAEPVPG--GQTSSPRRAWAAGAPAYPQWASQ 1302 Query: 209 VTRLDDSRPDK 241 + LD PDK Sbjct: 1303 PSVLDSINPDK 1313 >AB002298-1|BAA20760.2| 2847|Homo sapiens KIAA0300 protein. Length = 2847 Score = 30.3 bits (65), Expect = 9.0 Identities = 24/71 (33%), Positives = 31/71 (43%), Gaps = 4/71 (5%) Frame = +2 Query: 41 SVKTXDSGSAAGLCQGYPACNAXAPTCGWGRVGPGCDGRDGVQRRRSASGLAA----XTD 208 S +T DSGS G QG+P A + PG G+ RR A+G A + Sbjct: 1451 SSQTGDSGSQEGSAQGHPPAGAGGGSSCRAEPVPG--GQTSSPRRAWAAGAPAYPQWASQ 1508 Query: 209 VTRLDDSRPDK 241 + LD PDK Sbjct: 1509 PSVLDSINPDK 1519 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,750,897 Number of Sequences: 237096 Number of extensions: 1764563 Number of successful extensions: 8744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8734 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10538170902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -