BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A06 (916 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 2.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 5.1 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 8.9 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 8.9 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 8.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 2.2 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = -3 Query: 434 QVAILGHYHLELKEYHLEWFSLIIDNRPHQNE 339 Q + H+HL+ +HL+ ++ +RP+Q + Sbjct: 135 QETLQRHHHLQNHHHHLQSTAVQDHHRPYQQQ 166 Score = 23.4 bits (48), Expect = 2.9 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -1 Query: 688 EKEVDFASSKPLHVSVSTILFSTLM*RGFKETGIQTLITR 569 EKEV+ A KPL + FSTL G ++TL+ R Sbjct: 707 EKEVEKALLKPLLSLEDLVRFSTL--EGSGGDSLRTLLQR 744 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 5.1 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 530 LVQHPHWKGPLHQLGVEFFLGLDSWS 453 LV P W+ L+ VE LG + WS Sbjct: 902 LVTFPVWQVTLNARLVELSLGSNPWS 927 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 8.9 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 146 CLLLLXSSIAAQEKPREELPTR-ALRPRSTLTRKTTNALSSQSV 274 CL+++ S ++ KP E P R L S LT T +A S S+ Sbjct: 256 CLIVIMSWVSFWIKP-EAAPARVTLGVTSLLTLSTQHAKSQASL 298 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 8.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 107 CDILSAICNSIQKYCQ 60 C+I+ AIC + CQ Sbjct: 638 CNIMDAICTKLTADCQ 653 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.8 bits (44), Expect = 8.9 Identities = 6/21 (28%), Positives = 14/21 (66%) Frame = -3 Query: 410 HLELKEYHLEWFSLIIDNRPH 348 +LE+K Y+++W I+ + + Sbjct: 101 NLEIKNYNIDWDKCILSSESY 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,855 Number of Sequences: 438 Number of extensions: 4522 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29750994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -