BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A05 (928 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.0 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 3.9 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 3.9 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.4 bits (48), Expect = 3.0 Identities = 25/81 (30%), Positives = 39/81 (48%) Frame = -2 Query: 585 SSTSLFFSVTVPDNGE*ISLAAFTLSKAPHSSPALRSVPGSGSCAKTTSPRDSWAYSLTP 406 SS + FS +G + L F S A +S + S PG GS + + S S+ S++P Sbjct: 48 SSLNDLFSGPEESSGG-VELGWFNDSAAAITSTS-PSYPGGGSSSPSPSSPSSFFSSVSP 105 Query: 405 TVPISLSIVTHSCLSVYFLDD 343 T SL ++ +S F+ D Sbjct: 106 T---SLGSENYTGISDLFVFD 123 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.0 bits (47), Expect = 3.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 233 IQRCLLQIVKTYK 271 +QRCLL + KTY+ Sbjct: 435 LQRCLLSLEKTYE 447 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.0 bits (47), Expect = 3.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 233 IQRCLLQIVKTYK 271 +QRCLL + KTY+ Sbjct: 473 LQRCLLSLEKTYE 485 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,735 Number of Sequences: 438 Number of extensions: 4287 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 30234750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -