BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A03 (877 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 4.0 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 23 9.2 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 4.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 790 HXLTQVIEYTSSNSISDKLFSFFLIHITFPTCFKHCHSR 674 H L Q+ ++ +K +F L+H+ P C K C R Sbjct: 2735 HGLEQICGGSADFPSQEKAENF-LMHLLMPLCLKVCSGR 2772 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.4 bits (48), Expect = 9.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 614 IYPHGSVDKLPYATMGSGSLAA 679 I P S LP+A++GSG ++ Sbjct: 8 ISPSSSSSSLPFASLGSGKTSS 29 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 820,875 Number of Sequences: 2352 Number of extensions: 16309 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93853377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -