BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fdpeP01_F_A02 (881 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 25 0.70 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 22 8.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 8.6 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 25.4 bits (53), Expect = 0.70 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 387 YSNWPTIPQVFINGEFVGGCDIMLQMHQSGELIE 488 +S + T+ +++ E+V G D+M Q+ Q G+ E Sbjct: 51 HSCFQTMDRLYFVMEYVNGGDLMYQIQQCGKFKE 84 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/17 (47%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 362 FITQHIM-ALVRNCMHP 315 F T +++ A RNC+HP Sbjct: 25 FFTMYLVRAFCRNCIHP 41 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 8.6 Identities = 8/17 (47%), Positives = 12/17 (70%), Gaps = 1/17 (5%) Frame = -1 Query: 362 FITQHIM-ALVRNCMHP 315 F T +++ A RNC+HP Sbjct: 473 FFTMYLVRAFCRNCIHP 489 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,474 Number of Sequences: 438 Number of extensions: 3845 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28644972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -