Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P28_pT_P07
         (683 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY659931-1|AAT51799.1|  167|Anopheles gambiae lysozyme i-1 protein.    25   2.2  
AY324313-1|AAQ89698.1|  160|Anopheles gambiae insulin-like pepti...    23   9.0  

>AY659931-1|AAT51799.1|  167|Anopheles gambiae lysozyme i-1 protein.
          Length = 167

 Score = 25.0 bits (52), Expect = 2.2
 Identities = 14/46 (30%), Positives = 21/46 (45%)
 Frame = -1

Query: 392 LLILGFESGLIMCAHIAKRQELFTKQIDSACNACIVVGQSIIIGCN 255
           L+ +G  S L   +HIA  Q+     +   C +CI    S   GC+
Sbjct: 11  LIAIGVSSVLADVSHIAPPQQQLEDPVTDVCLSCICEASS---GCD 53


>AY324313-1|AAQ89698.1|  160|Anopheles gambiae insulin-like peptide
           6 precursor protein.
          Length = 160

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 7/9 (77%), Positives = 9/9 (100%)
 Frame = +2

Query: 494 YPSNWIYRH 520
           YPSN++YRH
Sbjct: 109 YPSNYMYRH 117


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 674,104
Number of Sequences: 2352
Number of extensions: 11122
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68995575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)