Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P28_pT_H09
         (666 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0449 + 5830017-5830272,5830376-5830620,5831994-5833019           32   0.47 

>04_01_0449 + 5830017-5830272,5830376-5830620,5831994-5833019
          Length = 508

 Score = 31.9 bits (69), Expect = 0.47
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 2/65 (3%)
 Frame = +1

Query: 268 KIGHSPIKTITSTTRGVYLVVNTLPYPSFIGXKKK--FIXQQCFRFRFVNLKYNKTSFLN 441
           +IG   I+ I  T   V+++   +PY  ++  K K  F       F F N   N T+F+ 
Sbjct: 351 RIGRVKIQLIGFTMMTVFMLCLAIPYDQWLRHKNKYGFAVMYGLTFFFANFGPNTTTFII 410

Query: 442 DSQIF 456
            ++IF
Sbjct: 411 PAEIF 415


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,450,423
Number of Sequences: 37544
Number of extensions: 266293
Number of successful extensions: 540
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 532
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 540
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1679486824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)