Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P28_pT_A11
         (534 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    22   4.5  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    22   4.5  
AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic ac...    22   4.5  
AY155490-1|AAO12861.1|  342|Apis mellifera Ammar1 transposase pr...    21   6.0  
AF069739-1|AAC63272.2|  690|Apis mellifera translation initiatio...    21   6.0  
AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.       21   7.9  

>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -3

Query: 337 QRVCSLRQASIRW 299
           ++VCSLR AS  W
Sbjct: 171 RQVCSLRMASYGW 183


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = -3

Query: 337 QRVCSLRQASIRW 299
           ++VCSLR AS  W
Sbjct: 171 RQVCSLRMASYGW 183


>AY569781-1|AAS75781.1|  461|Apis mellifera neuronal nicotinic
           acetylcholine Apisa7-2 subunit protein.
          Length = 461

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 22  KNHCPLICHP 51
           KN+CPL C P
Sbjct: 344 KNNCPLHCKP 353


>AY155490-1|AAO12861.1|  342|Apis mellifera Ammar1 transposase
           protein.
          Length = 342

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = +2

Query: 410 SLKEEKRGFRPV 445
           SLK+EKR  RPV
Sbjct: 56  SLKDEKRSGRPV 67


>AF069739-1|AAC63272.2|  690|Apis mellifera translation initiation
           factor 2 protein.
          Length = 690

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 423 RKGVSVRFRNAXY 461
           +KGVS+RF N  Y
Sbjct: 551 KKGVSLRFYNVVY 563


>AY898652-1|AAX83121.1|  349|Apis mellifera AKH receptor protein.
          Length = 349

 Score = 21.0 bits (42), Expect = 7.9
 Identities = 11/31 (35%), Positives = 16/31 (51%)
 Frame = -2

Query: 443 PDGNPFSLLLNFVSCPNYTYEFGSWLFFTIM 351
           P+   +S  + F + P YT+E    LF  IM
Sbjct: 181 PNVTWYSQCVTFNAFPTYTHEITYSLFGMIM 211


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 160,047
Number of Sequences: 438
Number of extensions: 3799
Number of successful extensions: 8
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15090993
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)