BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P28_F_M03
(881 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 2.8
>AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic
acetylcholine receptoralpha7-1 protein.
Length = 555
Score = 23.4 bits (48), Expect = 2.8
Identities = 12/35 (34%), Positives = 15/35 (42%)
Frame = -3
Query: 348 HHTTSGQRPSQGHCTPLYNKEPCVQPLFHSITAPL 244
HH T G S H TP ++ P H + PL
Sbjct: 415 HHHTMGHGHSHIHATPHHHHSHAATP-HHQHSTPL 448
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 227,016
Number of Sequences: 438
Number of extensions: 4791
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 28644972
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -