SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P28_F_E09
         (831 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_23878| Best HMM Match : Big_2 (HMM E-Value=0.65)                    29   6.1  

>SB_23878| Best HMM Match : Big_2 (HMM E-Value=0.65)
          Length = 1060

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 3/54 (5%)
 Frame = +2

Query: 218 TETIKTKQYLRNLLKARIFLGRYLERRLIDERIGYRDI---VLLSTAEVELKND 370
           T  I T QY   +LKA I +G Y   +++   +G +     +  +TA++ +KND
Sbjct: 529 TTLIVTYQYKSIVLKASITIGSYNPLKVLTVEVGNKPTAKNLYPATAQIHVKND 582


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,289,197
Number of Sequences: 59808
Number of extensions: 395371
Number of successful extensions: 907
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 863
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 907
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2335516755
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -