Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P28_F_A17
         (902 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A2FX24 Cluster: Putative uncharacterized protein; n=1; ...    37   0.61 

>UniRef50_A2FX24 Cluster: Putative uncharacterized protein; n=1;
           Trichomonas vaginalis G3|Rep: Putative uncharacterized
           protein - Trichomonas vaginalis G3
          Length = 357

 Score = 37.1 bits (82), Expect = 0.61
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 3/64 (4%)
 Frame = -3

Query: 429 YTAIAYITVI*-NSTIYTYFNYNVMFVKIQSFPDNVLIPIIYNNMSKVKE*P--SQSFFN 259
           +TAI +IT +  NS  Y   N  ++F+K+Q +P   L   I+N    + + P  S+ F  
Sbjct: 173 HTAIEFITYMAENSIFYENINIEIIFLKLQDYPSLTLKSSIFNMFIALSQSPTFSKQFIE 232

Query: 258 KGCL 247
           KG L
Sbjct: 233 KGFL 236


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 737,633,926
Number of Sequences: 1657284
Number of extensions: 12911009
Number of successful extensions: 25579
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 24649
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25524
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 81981722200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)