BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P28_F_A09
(638 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 3.3
U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 4.4
AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 22 4.4
AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 22 4.4
EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.8
EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.8
EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.8
EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.8
EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.8
EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 22 5.8
DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 22 5.8
DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 22 5.8
>AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation
factor 2 protein.
Length = 690
Score = 22.6 bits (46), Expect = 3.3
Identities = 12/50 (24%), Positives = 24/50 (48%)
Frame = +2
Query: 248 DIKNYLEKIYEVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVAFVTLPK 397
D+K LE + E ++D I GK +++ +K+ + V+ + K
Sbjct: 311 DLKGDLEGLVEGVIIDCSNHIGRGKLVTALIQRGTLKKGCLLVSGIASAK 360
>U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin
protein.
Length = 377
Score = 22.2 bits (45), Expect = 4.4
Identities = 8/9 (88%), Positives = 8/9 (88%)
Frame = -3
Query: 210 MLGSCFGCG 184
MLGS FGCG
Sbjct: 130 MLGSLFGCG 138
>AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength
rhodopsin protein.
Length = 152
Score = 22.2 bits (45), Expect = 4.4
Identities = 8/9 (88%), Positives = 8/9 (88%)
Frame = -3
Query: 210 MLGSCFGCG 184
MLGS FGCG
Sbjct: 96 MLGSLFGCG 104
>AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength
rhodopsin protein.
Length = 154
Score = 22.2 bits (45), Expect = 4.4
Identities = 8/9 (88%), Positives = 8/9 (88%)
Frame = -3
Query: 210 MLGSCFGCG 184
MLGS FGCG
Sbjct: 6 MLGSLFGCG 14
>EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 6 protein.
Length = 461
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 362 PSGYIRSAF 370
>EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 5 protein.
Length = 461
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 362 PSGYIRSAF 370
>EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 4 protein.
Length = 461
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 362 PSGYIRSAF 370
>EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 3 protein.
Length = 461
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 362 PSGYIRSAF 370
>EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 2 protein.
Length = 461
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 362 PSGYIRSAF 370
>EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine
receptor subunitalpha 6 transcript variant 1 protein.
Length = 461
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 362 PSGYIRSAF 370
>DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine
receptor alpha6subunit protein.
Length = 529
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 430 PSGYIRSAF 438
>DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine
receptor alpha6subunit protein.
Length = 529
Score = 21.8 bits (44), Expect = 5.8
Identities = 8/9 (88%), Positives = 9/9 (100%)
Frame = -2
Query: 538 PAGYIRSAF 512
P+GYIRSAF
Sbjct: 430 PSGYIRSAF 438
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,962
Number of Sequences: 438
Number of extensions: 3063
Number of successful extensions: 12
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19193721
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -