SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P28_F_A01
         (538 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   6.9  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   6.9  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   6.9  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   6.9  
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    21   9.1  

>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.9
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -1

Query: 97  WLICLFFHLWV 65
           W+ CL F  WV
Sbjct: 131 WMWCLIFAFWV 141


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.9
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -1

Query: 97  WLICLFFHLWV 65
           W+ CL F  WV
Sbjct: 131 WMWCLIFAFWV 141


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.9
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -1

Query: 97  WLICLFFHLWV 65
           W+ CL F  WV
Sbjct: 131 WMWCLIFAFWV 141


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.0 bits (42), Expect = 6.9
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -1

Query: 97  WLICLFFHLWV 65
           W+ CL F  WV
Sbjct: 131 WMWCLIFAFWV 141


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 20.6 bits (41), Expect = 9.1
 Identities = 12/44 (27%), Positives = 20/44 (45%)
 Frame = +1

Query: 4   PADLLFLS*IRYTKLKITMAKPKGERKGKSAINEVVTREYTVNL 135
           PADL  L+  R      +++KP+  R   S + +V    +   L
Sbjct: 366 PADLRLLTRGRLVLTVSSVSKPEALRLSGSVVTKVTCELFQATL 409


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,463
Number of Sequences: 336
Number of extensions: 1795
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13097125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -