BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fcaL-P17_pT_L15
(625 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
M29550-1|AAA35705.1| 514|Homo sapiens protein ( Human calcineur... 30 7.6
>M29550-1|AAA35705.1| 514|Homo sapiens protein ( Human calcineurin
A1 mRNA, complete cds. ).
Length = 514
Score = 29.9 bits (64), Expect = 7.6
Identities = 16/38 (42%), Positives = 22/38 (57%)
Frame = +2
Query: 164 NIKDAVLTVEKTTILYDPTTAFLFLTYYLCIHVTMYYT 277
NI + VL + ILY P+T FL + C H+T Y+T
Sbjct: 152 NINECVLYLWVLKILY-PSTLFLLRGNHECRHLTEYFT 188
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 75,735,373
Number of Sequences: 237096
Number of extensions: 1384220
Number of successful extensions: 5783
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5726
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5783
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6747805200
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -