SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fcaL-P17_pT_L10
         (584 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive o...    23   2.9  
AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin ...    23   2.9  
DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholi...    22   5.1  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    21   6.7  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    21   6.7  

>U70841-1|AAC47455.1|  377|Apis mellifera ultraviolet sensitive
           opsin protein.
          Length = 377

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = -2

Query: 535 QSLIRRSRS*NTGAINKIK*DFIIFYIMLLAW 440
           +SL+       +  +   K  F IF++ LLAW
Sbjct: 264 KSLVSNQDKERSAEVRIAKVAFTIFFLFLLAW 295


>AF004168-1|AAC13417.1|  377|Apis mellifera blue-sensitive opsin
           protein.
          Length = 377

 Score = 22.6 bits (46), Expect = 2.9
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = -2

Query: 535 QSLIRRSRS*NTGAINKIK*DFIIFYIMLLAW 440
           +SL+       +  +   K  F IF++ LLAW
Sbjct: 264 KSLVSNQDKERSAEVRIAKVAFTIFFLFLLAW 295


>DQ026039-1|AAY87898.1|  427|Apis mellifera nicotinic acetylcholine
           receptor beta2subunit protein.
          Length = 427

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 415 TPVCFFDHT 441
           TPVC +DHT
Sbjct: 156 TPVCEYDHT 164


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 531 VSLEGLDPEILE 496
           +SL G+DPE+ E
Sbjct: 191 ISLNGIDPELTE 202


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 531 VSLEGLDPEILE 496
           +SL G+DPE+ E
Sbjct: 229 ISLNGIDPELTE 240


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,770
Number of Sequences: 438
Number of extensions: 2829
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 16993167
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -